FAD-linked sulfhydryl oxidase ERV1 (ERV1) Recombinant Protein | ERV1 recombinant protein
Recombinant Arabidopsis thaliana FAD-linked sulfhydryl oxidase ERV1 (ERV1)
Gene Names
Erv1; AtErv1; EMB3106; EMBRYO DEFECTIVE 3106; F10F5.3; F10F5_3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
FAD-linked sulfhydryl oxidase ERV1 (ERV1); Recombinant Arabidopsis thaliana FAD-linked sulfhydryl oxidase ERV1 (ERV1); ERV1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-191, Full length protein
Sequence
MGEKPWQPLLQSFEKLSNCVQTHLSNFIGIKNTPPSSQSTIQNPIISLDSSPPIATNSSSLQKLPLKDKSTGPVTKEDLGRATWTFLHTLAAQYPEKPTRQQKKDVKELMTILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVDARWGKLECEQKSCDLHGTSMDF
Sequence Length
191
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,600 Da
NCBI Official Full Name
Erv1/Alr family protein
NCBI Official Symbol
Erv1
NCBI Official Synonym Symbols
AtErv1; EMB3106; EMBRYO DEFECTIVE 3106; F10F5.3; F10F5_3
NCBI Protein Information
Erv1/Alr family protein
UniProt Protein Name
FAD-linked sulfhydryl oxidase ERV1
Protein Family
UniProt Gene Name
ERV1
UniProt Synonym Gene Names
AtErv1
NCBI Description
Encodes Erv1, a component of the mitochondrial intermembrane space assembly machinery involved in the import pathway of the small intermembrane space proteins. It contains a Cys-X-Cys shuttle disulfide and oxidizes thioredoxin in vitro.
Uniprot Description
FAD-dependent sulfhydryl oxidase that catalyzes disulfide bond formation () (PubMed:14996837). Oxidizes thioredoxin in vitro (PubMed:14996837). Required for the import and folding of small cysteine-containing proteins in the mitochondrial intermembrane space. Forms a redox cycle with MIA40 that involves a disulfide relay system. Important for maintaining the cysteine residues in MIA40 in an oxidized state ().
Research Articles on ERV1
Similar Products
Product Notes
The ERV1 erv1 (Catalog #AAA1284832) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-191, Full length protein. The amino acid sequence is listed below: MGEKPWQPLL QSFEKLSNCV QTHLSNFIGI KNTPPSSQST IQNPIISLDS SPPIATNSSS LQKLPLKDKS TGPVTKEDLG RATWTFLHTL AAQYPEKPTR QQKKDVKELM TILSRMYPCR ECADHFKEIL RSNPAQAGSQ EEFSQWLCHV HNTVNRSLGK LVFPCERVDA RWGKLECEQK SCDLHGTSMD F. It is sometimes possible for the material contained within the vial of "FAD-linked sulfhydryl oxidase ERV1 (ERV1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
