Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cysteine/serine-rich nuclear protein 2 (CSRNP2) Recombinant Protein | CSRNP2 recombinant protein

Recombinant Human Cysteine/serine-rich nuclear protein 2 (CSRNP2)

Gene Names
CSRNP2; C12orf2; PPP1R72; TAIP-12; C12orf22; FAM130A1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cysteine/serine-rich nuclear protein 2 (CSRNP2); Recombinant Human Cysteine/serine-rich nuclear protein 2 (CSRNP2); CSRNP2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-543, Full length protein
Sequence
MDAFTGSGLKRKFDDVDVGSSVSNSDDEISSSDSADSCDSLNPPTTASFTPTSILKRQKQLRRKNVRFDQVTVYYFARRQGFTSVPSQGGSSLGMAQRHNSVRSYTLCEFAQEQEVNHREILREHLKEEKLHAKKMKLTKNGTVESVEADGLTLDDVSDEDIDVENVEVDDYFFLQPLPTKRRRALLRASGVHRIDAEEKQELRAIRLSREECGCDCRLYCDPEACACSQAGIKCQVDRMSFPCGCSRDGCGNMAGRIEFNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSASLDSSIESLGVCILEEPLAVPEELCPGLTAPILIQAQLPPGSSVLCFTENSDHPTASTVNSPSYLNSGPLVYYQVEQRPVLGVKGEPGTEEGSASFPKEKDLNVFSLPVTSLVACSSTDPAALCKSEVGKTPTLEALLPEDCNPEEPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLAV
Sequence Length
543
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,591 Da
NCBI Official Full Name
cysteine/serine-rich nuclear protein 2
NCBI Official Synonym Full Names
cysteine and serine rich nuclear protein 2
NCBI Official Symbol
CSRNP2
NCBI Official Synonym Symbols
C12orf2; PPP1R72; TAIP-12; C12orf22; FAM130A1
NCBI Protein Information
cysteine/serine-rich nuclear protein 2
UniProt Protein Name
Cysteine/serine-rich nuclear protein 2
UniProt Gene Name
CSRNP2
UniProt Synonym Gene Names
C12orf22; FAM130A1; TAIP12; CSRNP-2; TAIP-12

NCBI Description

The protein encoded by this gene belongs to the CSRNP family of nuclear proteins that share conserved regions, including cysteine- and serine- rich regions, a basic domain, a transcriptional activation domain, and bind the sequence 'AGAGTG', thus have the hallmark of transcription factors. Studies in mice suggest that these genes may have redundant functions. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

Binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity (). May play a role in apoptosis.

Research Articles on CSRNP2

Similar Products

Product Notes

The CSRNP2 csrnp2 (Catalog #AAA1282433) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-543, Full length protein. The amino acid sequence is listed below: MDAFTGSGLK RKFDDVDVGS SVSNSDDEIS SSDSADSCDS LNPPTTASFT PTSILKRQKQ LRRKNVRFDQ VTVYYFARRQ GFTSVPSQGG SSLGMAQRHN SVRSYTLCEF AQEQEVNHRE ILREHLKEEK LHAKKMKLTK NGTVESVEAD GLTLDDVSDE DIDVENVEVD DYFFLQPLPT KRRRALLRAS GVHRIDAEEK QELRAIRLSR EECGCDCRLY CDPEACACSQ AGIKCQVDRM SFPCGCSRDG CGNMAGRIEF NPIRVRTHYL HTIMKLELES KRQVSRPAAP DEEPSPTASC SLTGAQGSET QDFQEFIAEN ETAVMHLQSA EELERLKAEE DSSGSSASLD SSIESLGVCI LEEPLAVPEE LCPGLTAPIL IQAQLPPGSS VLCFTENSDH PTASTVNSPS YLNSGPLVYY QVEQRPVLGV KGEPGTEEGS ASFPKEKDLN VFSLPVTSLV ACSSTDPAAL CKSEVGKTPT LEALLPEDCN PEEPENEDFH PSWSPSSLPF RTDNEEGCGM VKTSQQNEDR PPEDSSLELP LAV. It is sometimes possible for the material contained within the vial of "Cysteine/serine-rich nuclear protein 2 (CSRNP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.