Helicase SRCAP (SRCAP) Recombinant Protein | SRCAP recombinant protein

Recombinant Human Helicase SRCAP (SRCAP) , partial

Cat. Num. AAA1280051

• Gene Names: SRCAP; EAF1; FLHS; SWR1; DOMO1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Helicase SRCAP (SRCAP); Recombinant Human Helicase SRCAP (SRCAP); partial; SRCAP recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-196. Fragment at the N-terminal, include the HSA(helicase/SANT-associated) domain
• Sequence: MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGPPGPPDGATVPLEGFSLSQAADLANKGPKWEKSHAEIAEQAKHEAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKEERARREEQAKLRRIAS
• Sequence Length: 196

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 146219843
• NCBI GeneID: 10847
• NCBI Accession #: NP_006653.2
• NCBI GenBank Nucleotide #: NM_006662.2
• UniProt Accession #: Q6ZRS2; O15026; Q7Z744; Q9Y5L9; B0JZA6
• Molecular Weight: 327,838 Da
• NCBI Official Full Name: helicase SRCAP
• NCBI Official Synonym Full Names: Snf2 related CREBBP activator protein
• NCBI Official Symbol: SRCAP
• NCBI Official Synonym Symbols: EAF1; FLHS; SWR1; DOMO1
• NCBI Protein Information: helicase SRCAP
• UniProt Protein Name: Helicase SRCAP
• Protein Family: Helicase
• UniProt Gene Name: SRCAP
• UniProt Synonym Gene Names: KIAA0309

NCBI Description

This gene encodes the core catalytic component of the multiprotein chromatin-remodeling SRCAP complex. The encoded protein is an ATPase that is necessary for the incorporation of the histone variant H2A.Z into nucleosomes. It can function as a transcriptional activator in Notch-mediated, CREB-mediated and steroid receptor-mediated transcription. Mutations in this gene cause Floating-Harbor syndrome, a rare disorder characterized by short stature, language deficits and dysmorphic facial features. [provided by RefSeq, Feb 2012]

Uniprot Description

Catalytic component of the SRCAP complex which mediates the ATP-dependent exchange of histone H2AZ/H2B dimers for nucleosomal H2A/H2B, leading to transcriptional regulation of selected genes by chromatin remodeling. Acts as a coactivator for CREB-mediated transcription, steroid receptor-mediated transcription, and Notch-mediated transcription.