Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

C-X-C motif chemokine 13 Recombinant Protein | CXCL13 recombinant protein

Recombinant Human C-X-C motif chemokine 13 protein

Gene Names
CXCL13; BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C motif chemokine 13; Recombinant Human C-X-C motif chemokine 13 protein; AngieB cell-attracting chemokine 1; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13; CXCL13 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-95aa; Partial
Sequence
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS
Sequence Length
109
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CXCL13 recombinant protein
Chotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
Product Categories/Family for CXCL13 recombinant protein
References
A B-cell-homing chemokine made in lymphoid follicles activates Burkitt's lymphoma receptor-1.Gunn M.D., Ngo V.N., Ansel K.M., Ekland E.H., Cyster J.G., Williams L.T.Nature 391:799-803(1998) B cell-attracting chemokine 1, a human CXC chemokine expressed in lymphoid tissues, selectively attracts B lymphocytes via BLR1/CXCR5.Legler D.F., Loetscher M., Stuber Roos R., Clark-Lewis I., Baggiolini M., Moser B.J. Exp. Med. 187:655-660(1998) Napolitano M., Spinetti G., Gaetano C., Capogrossi C.M.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.8 kDa
NCBI Official Full Name
C-X-C motif chemokine 13
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 13
NCBI Official Symbol
CXCL13
NCBI Official Synonym Symbols
BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13
NCBI Protein Information
C-X-C motif chemokine 13
UniProt Protein Name
C-X-C motif chemokine 13
Protein Family
UniProt Gene Name
CXCL13
UniProt Synonym Gene Names
BCA1; BLC; SCYB13; BCA-1
UniProt Entry Name
CXL13_HUMAN

NCBI Description

B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq, Oct 2014]

Uniprot Description

CXCL13: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B- lymphocytes. Binds to BLR1/CXCR5. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: cytosol; extracellular region; extracellular space

Molecular Function: CCR10 chemokine receptor binding; chemokine activity; CXCR3 chemokine receptor binding; CXCR5 chemokine receptor binding; fibroblast growth factor binding; heparin binding; protein heterodimerization activity; receptor agonist activity

Biological Process: cell surface receptor linked signal transduction; cell-cell signaling; chronic inflammatory response; defense response to bacterium; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; germinal center formation; immune response; inflammatory response; lymph node development; lymphocyte chemotaxis across high endothelial venule; positive regulation of cell-cell adhesion mediated by integrin; positive regulation of integrin activation; regulation of angiogenesis; regulation of cell proliferation; regulation of humoral immune response; response to lipopolysaccharide

Research Articles on CXCL13

Similar Products

Product Notes

The CXCL13 cxcl13 (Catalog #AAA1265617) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-95aa; Partial. The amino acid sequence is listed below: VLEVYYTSLR CRCVQESSVF IPRRFIDRIQ ILPRGNGCPR KEIIVWKKNK SIVCVDPQAE WIQRMMEVLR KRS. It is sometimes possible for the material contained within the vial of "C-X-C motif chemokine 13, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.