SDS-PAGE
Protein-lysine 6-oxidase Recombinant Protein | LOX recombinant protein
Recombinant Human Protein-lysine 6-oxidase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein-lysine 6-oxidase; Recombinant Human Protein-lysine 6-oxidase; Lysyl oxidase; LOX recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
174-417aa; Partial
Sequence
PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Sequence Length
417
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for LOX recombinant protein
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. In addition to cross-linking of extracellular matrix proteins, may have a direct role in tumor suppression.
Product Categories/Family for LOX recombinant protein
References
Molecular cloning of human lysyl oxidase and assignment of the gene to chromosome 5q23.3-31.2.Haemaelaeinen E.-R., Jones T.A., Sheer D., Taskinen K., Pihlajaniemi T., Kivirikko K.I.Genomics 11:508-516(1991)
The complete derived amino acid sequence of human lysyl oxidase and assignment of the gene to chromosome 5 (extensive sequence homology with the murine ras recision gene)
.Mariani T.J., Trackman P.C., Kagan H.M., Eddy R.L., Shows T.B., Boyd C.D., Deak S.B.Matrix 12:242-248(1992)
A new gene with sequence and structural similarity to the gene encoding human lysyl oxidase.Kim Y., Boyd C.D., Csiszar K.J. Biol. Chem. 270:7176-7182(1995)
Epigenetic inhibition of lysyl oxidase transcription after transformation by ras oncogene.Contente S., Kenyon K., Sriraman P., Subramanyan S., Friedman R.M.Mol. Cell. Biochem. 194:79-91(1999)
Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)
Structure of the human lysyl oxidase gene.Haemaelaeinen E.-R., Kemppainen R., Pihlajaniemi T., Kivirikko K.I.Genomics 17:544-548(1993)
Characterization of the human lysyl oxidase gene locus.Svinarich D.M., Twomey T.A., Macauley S.P., Krebs C.J., Yang T.P., Krawetz S.A.J. Biol. Chem. 267:14382-14387(1992)
A restriction fragment length polymorphism results in a nonconservative amino acid substitution encoded within the first exon of the human lysyl oxidase gene.Csiszar K., Mariani T.J., Gosin J.S., Deak S.B., Boyd C.D.Genomics 16:401-406(1993)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32.4 kDa
NCBI Official Full Name
protein-lysine 6-oxidase isoform 1 preproprotein
NCBI Official Synonym Full Names
lysyl oxidase
NCBI Official Symbol
LOX
NCBI Protein Information
protein-lysine 6-oxidase
UniProt Protein Name
Protein-lysine 6-oxidase
Protein Family
UniProt Gene Name
LOX
UniProt Entry Name
LYOX_HUMAN
NCBI Description
This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme. The copper-dependent amine oxidase activity of this enzyme functions in the crosslinking of collagens and elastin, while the propeptide may play a role in tumor suppression. [provided by RefSeq, Nov 2015]
Uniprot Description
LOX: Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. In addition to cross-linking of extracellular matrix proteins, may have a direct role in tumor suppression. Belongs to the lysyl oxidase family.
Protein type: Secreted, signal peptide; Oxidoreductase; Secreted; EC 1.4.3.13
Chromosomal Location of Human Ortholog: 5q23.2
Cellular Component: collagen; extracellular region; extracellular space; nucleus; proteinaceous extracellular matrix
Molecular Function: copper ion binding; protein binding; protein-lysine 6-oxidase activity
Biological Process: collagen fibril organization; elastic fiber assembly; extracellular matrix organization and biogenesis; heart development; lung development; protein modification process; response to drug; response to steroid hormone stimulus; wound healing
Disease: Cutis Laxa, Autosomal Recessive, Type Ia
Research Articles on LOX
1. LOX gene expression is a predictive factor in hepatocellular liver cancer prognosis and mortality.
Similar Products
Product Notes
The LOX lox (Catalog #AAA1265512) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 174-417aa; Partial. The amino acid sequence is listed below: PYKYSDDNPY YNYYDTYERP RPGGRYRPGY GTGYFQYGLP DLVADPYYIQ ASTYVQKMSM YNLRCAAEEN CLASTAYRAD VRDYDHRVLL RFPQRVKNQG TSDFLPSRPR YSWEWHSCHQ HYHSMDEFSH YDLLDANTQR RVAEGHKASF CLEDTSCDYG YHRRFACTAH TQGLSPGCYD TYGADIDCQW IDITDVKPGN YILKVSVNPS YLVPESDYTN NVVRCDIRYT GHHAYASGCT ISPY. It is sometimes possible for the material contained within the vial of "Protein-lysine 6-oxidase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
