Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Vasopressin V1b receptor Recombinant Protein | Avpr1b recombinant protein

Recombinant Rat Vasopressin V1b receptor

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vasopressin V1b receptor; Recombinant Rat Vasopressin V1b receptor; AVPR V1b; AVPR V3; Antidiuretic hormone receptor 1b; Vasopressin V3 receptor; Avpr1b recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
343-425aa; Partial
Sequence
NSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF
Sequence Length
425
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Avpr1b recombinant protein
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.
References
Molecular cloning and characterization of rat V1b vasopressin receptor evidence for its expression in extra-pituitary tissues.Saito M., Sugimoto T., Tahara A., Kawashima H.Biochem. Biophys. Res. Commun. 212:751-757(1995) Extrapituitary expression of the rat V1b vasopressin receptor gene.Lolait S.J., O'Carroll A.-M., Mahan L.C., Felder C.C., Button D.C., Young W.S. III, Mezey E., Brownstein M.J.Proc. Natl. Acad. Sci. U.S.A. 92:6783-6787(1995)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
13 kDa
NCBI Official Full Name
Vasopressin V1b receptor
NCBI Official Synonym Full Names
arginine vasopressin receptor 1B
NCBI Official Symbol
Avpr1b
NCBI Protein Information
vasopressin V1b receptor
UniProt Protein Name
Vasopressin V1b receptor
Protein Family
UniProt Gene Name
Avpr1b
UniProt Synonym Gene Names
V1bR
UniProt Entry Name
V1BR_RAT

NCBI Description

may play a role in the regulation of cerebrospinal fluid water content [RGD, Feb 2006]

Uniprot Description

AVPR1B: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl- inositol-calcium second messenger system. Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1

Cellular Component: cytosol; integral to membrane; integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; peptide hormone binding; protein homodimerization activity; vasopressin receptor activity

Biological Process: cellular response to hormone stimulus; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cAMP nucleotide second messenger; hyperosmotic salinity response; positive regulation of cellular pH reduction; positive regulation of glutamate secretion; positive regulation of vasoconstriction; regulation of systemic arterial blood pressure by vasopressin

Research Articles on Avpr1b

Similar Products

Product Notes

The Avpr1b avpr1b (Catalog #AAA1265499) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 343-425aa; Partial. The amino acid sequence is listed below: NSRLLPRSLS HHACCTGSKP QVHRQLSTSS LTSRRTTLLT HACGSPTLRL SLNLSLRAKP RPAGSLKDLE QVDGEATMET SIF. It is sometimes possible for the material contained within the vial of "Vasopressin V1b receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.