DNA (cytosine-5)-methyltransferase 3A (DNMT3A) Recombinant Protein | DNMT3A recombinant protein

Recombinant Human DNA (cytosine-5)-methyltransferase 3A (DNMT3A), partial

Cat. Num. AAA1265409

• Gene Names: DNMT3A; TBRS; DNMT3A2; M.HsaIIIA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA (cytosine-5)-methyltransferase 3A (DNMT3A); Recombinant Human DNA (cytosine-5)-methyltransferase 3A (DNMT3A); partial; DNA methyltransferase HsaIIIA; DNA MTase HsaIIIA; M.HsaIIIA; DNMT3A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 680-902. Partial
• Sequence: KIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLF

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DNMT3A recombinant protein

Required for genome-wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. It modifies DNA in a non-processive manner and also methylates non-CpG sites. May preferentially methylate DNA linker between 2 nucleosomal cores and is inhibited by histone H1. Plays a role in paternal and maternal imprinting. Required for methylation of most imprinted loci in germ cells. Acts as a transcriptional corepressor for ZBTB18. Recruited to trimethylated 'Lys-36' of histone H3 (H3K36me3) sites. Can actively repress transcription through the recruitment of HDAC activity.

Product Categories/Family for DNMT3A recombinant protein

Epigenetics and Nuclear Signaling

References

Cloning, expression and chromosome locations of the human DNMT3 gene family.Xie S., Wang Z., Okano M., Nogami M., Li Y., He W.-W., Okumura K., Li E.Gene 236:87-95(1999) A novel Dnmt3a isoform produced from an alternative promoter localizes to euchromatin and its expression correlates with active de novo methylation.Chen T., Ueda Y., Xie S., Li E.J. Biol. Chem. 277:38746-38754(2002) Co-operation and communication between the human maintenance and de novo DNA (cytosine-5) methyltransferases.Kim G.-D., Ni J., Kelesoglu N., Roberts R.J., Pradhan S.EMBO J. 21:4183-4195(2002) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 12751473
• NCBI GeneID: 1788
• NCBI Accession #: NP_072046.2
• NCBI GenBank Nucleotide #: NM_022552.4
• UniProt Accession #: Q9Y6K1; Q86TE8; Q86XF5; Q8IZV0; Q8WXU9; E9PEB8
• Molecular Weight: 29.9 kDa
• NCBI Official Full Name: DNA (cytosine-5)-methyltransferase 3A isoform a
• NCBI Official Synonym Full Names: DNA (cytosine-5-)-methyltransferase 3 alpha
• NCBI Official Symbol: DNMT3A
• NCBI Official Synonym Symbols: TBRS; DNMT3A2; M.HsaIIIA
• NCBI Protein Information: DNA (cytosine-5)-methyltransferase 3A
• UniProt Protein Name: DNA (cytosine-5)-methyltransferase 3A
• Protein Family: DNA
• UniProt Gene Name: DNMT3A
• UniProt Synonym Gene Names: Dnmt3a; DNA MTase HsaIIIA; M.HsaIIIA
• UniProt Entry Name: DNM3A_HUMAN

NCBI Description

CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

DNMT3A: a DNA methyltransferase required for genome wide de novo methylation and essential for development. DNA methylation is coordinated with methylation of histones. Prefers CpG methylation to CpA, CpT, and CpC methylation. Methylates CpG sites at a rate much slower than DNMT1, but greater than DNMT3b. Methylation is coordinated with methylation of histones. Binds the ZNF238 transcriptional repressor. Interacts with SETDB1 and DNMT1. Can co-localize with heterochromatin protein (HP1 ) and methyl-CpG binding protein (MeCBP). Associates with HDAC1 through its ADD-type zinc-finger. Highly expressed in fetal tissues, skeletal muscle, heart, peripheral blood mononuclear cells, kidney, and at lower levels in placenta, brain, liver, colon, spleen, small intestine and lung.

Protein type: Methyltransferase, DNA; Amino Acid Metabolism - cysteine and methionine; EC 2.1.1.37; Methyltransferase

Chromosomal Location of Human Ortholog: 2p23

Cellular Component: chromosome, pericentric region; cytoplasm; euchromatin; nuclear heterochromatin; nuclear matrix; nucleoplasm; nucleus; XY body

Molecular Function: chromatin binding; DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; DNA binding; DNA-methyltransferase activity; identical protein binding; metal ion binding; protein binding; unmethylated CpG binding

Biological Process: aging; cytosine methylation within a CG sequence; DNA methylation; DNA methylation during embryonic development; DNA methylation during gametogenesis; DNA methylation on cytosine; establishment and/or maintenance of chromatin architecture; gene expression; genetic imprinting; methylation-dependent chromatin silencing; mitotic cell cycle; negative regulation of gene expression, epigenetic; negative regulation of transcription from RNA polymerase II promoter; neuron differentiation; regulation of gene expression, epigenetic; response to cocaine; response to estradiol stimulus; response to ionizing radiation; response to lead ion; response to toxin; response to vitamin A; S-adenosylhomocysteine metabolic process; S-adenosylmethioninamine metabolic process; spermatogenesis

Disease: Tatton-brown-rahman Syndrome