Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

DNA (cytosine-5)-methyltransferase 3A (DNMT3A) Recombinant Protein | DNMT3A recombinant protein

Recombinant Human DNA (cytosine-5)-methyltransferase 3A (DNMT3A), partial

Gene Names
DNMT3A; TBRS; DNMT3A2; M.HsaIIIA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA (cytosine-5)-methyltransferase 3A (DNMT3A); Recombinant Human DNA (cytosine-5)-methyltransferase 3A (DNMT3A); partial; DNA methyltransferase HsaIIIA; DNA MTase HsaIIIA; M.HsaIIIA; DNMT3A recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
680-902. Partial
Sequence
KIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLF
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DNMT3A recombinant protein
Required for genome-wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. It modifies DNA in a non-processive manner and also methylates non-CpG sites. May preferentially methylate DNA linker between 2 nucleosomal cores and is inhibited by histone H1. Plays a role in paternal and maternal imprinting. Required for methylation of most imprinted loci in germ cells. Acts as a transcriptional corepressor for ZBTB18. Recruited to trimethylated 'Lys-36' of histone H3 (H3K36me3) sites. Can actively repress transcription through the recruitment of HDAC activity.
Product Categories/Family for DNMT3A recombinant protein
References
Cloning, expression and chromosome locations of the human DNMT3 gene family.Xie S., Wang Z., Okano M., Nogami M., Li Y., He W.-W., Okumura K., Li E.Gene 236:87-95(1999) A novel Dnmt3a isoform produced from an alternative promoter localizes to euchromatin and its expression correlates with active de novo methylation.Chen T., Ueda Y., Xie S., Li E.J. Biol. Chem. 277:38746-38754(2002) Co-operation and communication between the human maintenance and de novo DNA (cytosine-5) methyltransferases.Kim G.-D., Ni J., Kelesoglu N., Roberts R.J., Pradhan S.EMBO J. 21:4183-4195(2002) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.9 kDa
NCBI Official Full Name
DNA (cytosine-5)-methyltransferase 3A isoform a
NCBI Official Synonym Full Names
DNA (cytosine-5-)-methyltransferase 3 alpha
NCBI Official Symbol
DNMT3A
NCBI Official Synonym Symbols
TBRS; DNMT3A2; M.HsaIIIA
NCBI Protein Information
DNA (cytosine-5)-methyltransferase 3A
UniProt Protein Name
DNA (cytosine-5)-methyltransferase 3A
Protein Family
DNA
UniProt Gene Name
DNMT3A
UniProt Synonym Gene Names
Dnmt3a; DNA MTase HsaIIIA; M.HsaIIIA
UniProt Entry Name
DNM3A_HUMAN

NCBI Description

CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

DNMT3A: a DNA methyltransferase required for genome wide de novo methylation and essential for development. DNA methylation is coordinated with methylation of histones. Prefers CpG methylation to CpA, CpT, and CpC methylation. Methylates CpG sites at a rate much slower than DNMT1, but greater than DNMT3b. Methylation is coordinated with methylation of histones. Binds the ZNF238 transcriptional repressor. Interacts with SETDB1 and DNMT1. Can co-localize with heterochromatin protein (HP1 ) and methyl-CpG binding protein (MeCBP). Associates with HDAC1 through its ADD-type zinc-finger. Highly expressed in fetal tissues, skeletal muscle, heart, peripheral blood mononuclear cells, kidney, and at lower levels in placenta, brain, liver, colon, spleen, small intestine and lung.

Protein type: Methyltransferase, DNA; Amino Acid Metabolism - cysteine and methionine; EC 2.1.1.37; Methyltransferase

Chromosomal Location of Human Ortholog: 2p23

Cellular Component: chromosome, pericentric region; cytoplasm; euchromatin; nuclear heterochromatin; nuclear matrix; nucleoplasm; nucleus; XY body

Molecular Function: chromatin binding; DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; DNA binding; DNA-methyltransferase activity; identical protein binding; metal ion binding; protein binding; unmethylated CpG binding

Biological Process: aging; cytosine methylation within a CG sequence; DNA methylation; DNA methylation during embryonic development; DNA methylation during gametogenesis; DNA methylation on cytosine; establishment and/or maintenance of chromatin architecture; gene expression; genetic imprinting; methylation-dependent chromatin silencing; mitotic cell cycle; negative regulation of gene expression, epigenetic; negative regulation of transcription from RNA polymerase II promoter; neuron differentiation; regulation of gene expression, epigenetic; response to cocaine; response to estradiol stimulus; response to ionizing radiation; response to lead ion; response to toxin; response to vitamin A; S-adenosylhomocysteine metabolic process; S-adenosylmethioninamine metabolic process; spermatogenesis

Disease: Tatton-brown-rahman Syndrome

Research Articles on DNMT3A

Similar Products

Product Notes

The DNMT3A dnmt3a (Catalog #AAA1265409) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 680-902. Partial. The amino acid sequence is listed below: KIMYVGDVRS VTQKHIQEWG PFDLVIGGSP CNDLSIVNPA RKGLYEGTGR LFFEFYRLLH DARPKEGDDR PFFWLFENVV AMGVSDKRDI SRFLESNPVM IDAKEVSAAH RARYFWGNLP GMNRPLASTV NDKLELQECL EHGRIAKFSK VRTITTRSNS IKQGKDQHFP VFMNEKEDIL WCTEMERVFG FPVHYTDVSN MSRLARQRLL GRSWSVPVIR HLF . It is sometimes possible for the material contained within the vial of "DNA (cytosine-5)-methyltransferase 3A (DNMT3A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual