CBK1 kinase activator protein MOB2 (MOB2) Recombinant Protein | MOB2 recombinant protein
Recombinant Saccharomyces cerevisiae CBK1 kinase activator protein MOB2 (MOB2)
Gene Names
MOB2; YFL035C; YFL035C-A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CBK1 kinase activator protein MOB2 (MOB2); Recombinant Saccharomyces cerevisiae CBK1 kinase activator protein MOB2 (MOB2); MOB2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-287, full length protein
Sequence
MSFFNFKAFGRNSKKNKNQPLNVAQPPAMNTIYSSPHSSNSRLSLRNKHHSPKRHSQTSFPAQKSTPQSQQLTSTTPQSQQQEASERSESQQIMFLSEPFVRTALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVTPDAYPTMNAGPHTDYLWLDANNRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQMFRIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLPLIESFEKQGKIIYN
Sequence Length
287
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,276 Da
NCBI Official Full Name
Mob2p
NCBI Official Symbol
MOB2
NCBI Official Synonym Symbols
YFL035C; YFL035C-A
NCBI Protein Information
Mob2p
UniProt Protein Name
CBK1 kinase activator protein MOB2
Protein Family
UniProt Gene Name
MOB2
Uniprot Description
Functions as an activator subunit for the CBK1 protein kinase. Part of the regulation of ACE2 activity and cellular morphogenesis (RAM) signaling network. Required for coordinating polarized cell growth during interphase with the onset of mitosis. Required for mother/daughter cell separation after cytokinesis. Also has a role in the prevention of nuclear export of ACE2 from the daughter cell nucleus after mitotic exit. It coordinates ACE2-dependent transcription with mitotic exit network activation.
Research Articles on MOB2
Similar Products
Product Notes
The MOB2 mob2 (Catalog #AAA1262957) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-287, full length protein. The amino acid sequence is listed below: MSFFNFKAFG RNSKKNKNQP LNVAQPPAMN TIYSSPHSSN SRLSLRNKHH SPKRHSQTSF PAQKSTPQSQ QLTSTTPQSQ QQEASERSES QQIMFLSEPF VRTALVKGSF KTIVQLPKYV DLGEWIALNV FEFFTNLNQF YGVVAEYVTP DAYPTMNAGP HTDYLWLDAN NRQVSLPASQ YIDLALTWIN NKVNDKNLFP TKNGLPFPQQ FSRDVQRIMV QMFRIFAHIY HHHFDKIVHL SLEAHWNSFF SHFISFAKEF KIIDRKEMAP LLPLIESFEK QGKIIYN. It is sometimes possible for the material contained within the vial of "CBK1 kinase activator protein MOB2 (MOB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
