Protein virB2 (virB2) Recombinant Protein | virB2 recombinant protein
Recombinant Agrobacterium tumefaciens Protein virB2 (virB2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein virB2 (virB2); Recombinant Agrobacterium tumefaciens Protein virB2 (virB2); Recombinant Protein virB2 (virB2); Protein virB2; virB2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-121
Sequence
VMRMVSGYAPSVVGAMGWSIFSSGPAAAQSAGGGTDPATMVNNICTFILGPFGQSLAVLGIVAIGISWMFGRASLGLVAGVVGGIVIMFGASFLGKTLTGGG
Sequence Length
121
Species
Agrobacterium tumefaciens (strain C58 / ATCC 33970)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,318 Da
NCBI Official Full Name
component of type IV secretion system, pilin subunit
NCBI Official Symbol
virB2
NCBI Protein Information
type IV secretion system pilin subunit VirB2
UniProt Protein Name
Protein virB2
Protein Family
UniProt Gene Name
virB2
UniProt Entry Name
VIRB2_AGRT5
Uniprot Description
Function: VirB proteins are suggested to act at the bacterial surface and there play an important role in directing T-DNA transfer to plant cells.
Subunit structure: Interacts with host plant RTNLB1 protein
By similarity.
Subcellular location: Cell outer membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the virB2 family.
Similar Products
Product Notes
The virB2 virb2 (Catalog #AAA1261014) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-121. The amino acid sequence is listed below: VMRMVSGYAP SVVGAMGWSI FSSGPAAAQS AGGGTDPATM VNNICTFILG PFGQSLAVLG IVAIGISWMF GRASLGLVAG VVGGIVIMFG ASFLGKTLTG GG. It is sometimes possible for the material contained within the vial of "Protein virB2 (virB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
