Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Thiazole synthase (thiG) Recombinant Protein | thiG recombinant protein

Recombinant Campylobacter jejuni subsp. doylei Thiazole synthase (thiG)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thiazole synthase (thiG); Recombinant Campylobacter jejuni subsp. doylei Thiazole synthase (thiG); Recombinant Thiazole synthase (thiG); Thiazole synthase EC= 2.8.1.10; thiG recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-258aa; full length protein
Sequence
MQENLKNDKLKIGKYEFDSRFILGSGKYSLELIKSSIEEAKAQIITLALRRANTGEIANI LDYIPKNITLLPNTSGARNADEALRIARLSRELGCGELIKIEVISDSRYLLPDNYETIKA CELLAKEGFTPLPYMHADLYAARAMRDVGAAAIMPLAAPIGSNKGLCAKEFIQILLNEID LPIIVDAGIGTPAQACEAMQMGVSAVMVNTAIAEAKDIALMARAFSLAVNAGRAAFLAGL ASVSEAKASSPLTGFLRD
Sequence Length
258
Species
Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,675 Da
NCBI Official Full Name
thiazole synthase
NCBI Official Symbol
thiG
NCBI Protein Information
thiazole synthase
UniProt Protein Name
Thiazole synthase
Protein Family
UniProt Gene Name
thiG
UniProt Entry Name
THIG_CAMJD

Uniprot Description

Function: Catalyzes the rearrangement of 1-deoxy-D-xylulose 5-phosphate (DXP) to produce the thiazole phosphate moiety of thiamine. Sulfur is provided by the thiocarboxylate moiety of the carrier protein ThiS. In vitro, sulfur can be provided by H2S

By similarity. HAMAP-Rule MF_00443

Catalytic activity: 1-deoxy-D-xylulose 5-phosphate + 2-iminoacetate + thiocarboxy-adenylate-[sulfur-carrier protein ThiS] = 2-((2R,5Z)-2-carboxy-4-methylthiazol-5(2H)-ylidene)ethyl phosphate + [sulfur-carrier protein ThiS] + 2 H2O. HAMAP-Rule MF_00443

Pathway: Cofactor biosynthesis; thiamine diphosphate biosynthesis. HAMAP-Rule MF_00443

Subunit structure: Homotetramer. Forms heterodimers with either ThiH or ThiS

By similarity.

Subcellular location: Cytoplasm

By similarity HAMAP-Rule MF_00443.

Sequence similarities: Belongs to the ThiG family.

Similar Products

Product Notes

The thiG thig (Catalog #AAA1260713) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-258aa; full length protein. The amino acid sequence is listed below: MQENLKNDKL KIGKYEFDSR FILGSGKYSL ELIKSSIEEA KAQIITLALR RANTGEIANI LDYIPKNITL LPNTSGARNA DEALRIARLS RELGCGELIK IEVISDSRYL LPDNYETIKA CELLAKEGFT PLPYMHADLY AARAMRDVGA AAIMPLAAPI GSNKGLCAKE FIQILLNEID LPIIVDAGIG TPAQACEAMQ MGVSAVMVNT AIAEAKDIAL MARAFSLAVN AGRAAFLAGL ASVSEAKASS PLTGFLRD. It is sometimes possible for the material contained within the vial of "Thiazole synthase (thiG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.