Probable beta-1,3-galactosyltransferase 20 (B3GALT20) Recombinant Protein | AT4G21060 recombinant protein
Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 20 (B3GALT20)
Gene Names
AT4G21060; T13K14.220; T13K14_220
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable beta-1; 3-galactosyltransferase 20 (B3GALT20); Recombinant Arabidopsis thaliana Probable beta-1; Recombinant Probable beta-1; 3-galactosyltransferase 20 EC= 2.4.1.-; AT4G21060 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-684
Sequence
MKRVKSESFRGVYSSRRFKLSHFLLAIAGFYLVFLAFKFPHFIEMVAMLSGDTGLDGALSDTSLDVSLSGSLRNDMLNRKLEDEDHQSGPSTTQKVSPEEKINGSKQIQPLLFRYGRISGEVMRRRNRTIHMSPFERMADEAWILGSKAWEDVDKFEVDKINESASIFEGKVESCPSQISMNGDDLNKANRIMLLPCGLAAGSSITILGTPQYAHKESVPQRSRLTRSYGMVLVSQFMVELQGLKTGDGEYPPKILHLNPRIKGDWNHRPVIEHNTCYRMQWGVAQRCDGTPSKKDADVLVDGFRRCEKWTQNDIIDMVDSKESKTTSWFKRFIGREQKPEVTWSFPFAEGKVFVLTLRAGIDGFHINVGGRHVSSFPYRPGFTIEDATGLAVTGDVDIHSIHATSLSTSHPSFSPQKAIEFSSEWKAPPLPGTPFRLFMGVLSATNHFSERMAVRKTWMQHPSIKSSDVVARFFVALNPRKEVNAMLKKEAEYFGDIVILPFMDRYELVVLKTIAICEFGVQNVTAPYIMKCDDDTFIRVESILKQIDGVSPEKSLYMGNLNLRHRPLRTGKWTVTWEEWPEAVYPPYANGPGYIISSNIAKYIVSQNSRHKLRLFKMEDVSMGLWVEQFNASMQPVEYSHSWKFCQYGCTLNYYTAHYQSPSQMMCLWDNLLKGRPQCCNFR
Sequence Length
684
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
77,912 Da
NCBI Official Full Name
Galactosyltransferase family protein
NCBI Official Symbol
AT4G21060
NCBI Official Synonym Symbols
T13K14.220; T13K14_220
NCBI Protein Information
Galactosyltransferase family protein
UniProt Protein Name
Probable beta-1,3-galactosyltransferase 20
UniProt Gene Name
B3GALT20
UniProt Entry Name
B3GTK_ARATH
Uniprot Description
Function: Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue
By similarity.
Cofactor: Manganese
By similarity.
Pathway: Protein modification; protein glycosylation.
Subcellular location: Golgi apparatus membrane; Single-pass type II membrane protein
Probable.
Tissue specificity: Expressed in stems and at lower levels in cauline leaves and siliques. Ref.1
Sequence similarities: Belongs to the glycosyltransferase 31 family.Contains 1 galectin domain.
Sequence caution: The sequence CAB45901.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAB79106.1 differs from that shown. Reason: Erroneous gene model prediction.
Similar Products
Product Notes
The AT4G21060 b3galt20 (Catalog #AAA1257144) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-684. The amino acid sequence is listed below: MKRVKSESFR GVYSSRRFKL SHFLLAIAGF YLVFLAFKFP HFIEMVAMLS GDTGLDGALS DTSLDVSLSG SLRNDMLNRK LEDEDHQSGP STTQKVSPEE KINGSKQIQP LLFRYGRISG EVMRRRNRTI HMSPFERMAD EAWILGSKAW EDVDKFEVDK INESASIFEG KVESCPSQIS MNGDDLNKAN RIMLLPCGLA AGSSITILGT PQYAHKESVP QRSRLTRSYG MVLVSQFMVE LQGLKTGDGE YPPKILHLNP RIKGDWNHRP VIEHNTCYRM QWGVAQRCDG TPSKKDADVL VDGFRRCEKW TQNDIIDMVD SKESKTTSWF KRFIGREQKP EVTWSFPFAE GKVFVLTLRA GIDGFHINVG GRHVSSFPYR PGFTIEDATG LAVTGDVDIH SIHATSLSTS HPSFSPQKAI EFSSEWKAPP LPGTPFRLFM GVLSATNHFS ERMAVRKTWM QHPSIKSSDV VARFFVALNP RKEVNAMLKK EAEYFGDIVI LPFMDRYELV VLKTIAICEF GVQNVTAPYI MKCDDDTFIR VESILKQIDG VSPEKSLYMG NLNLRHRPLR TGKWTVTWEE WPEAVYPPYA NGPGYIISSN IAKYIVSQNS RHKLRLFKME DVSMGLWVEQ FNASMQPVEY SHSWKFCQYG CTLNYYTAHY QSPSQMMCLW DNLLKGRPQC CNFR. It is sometimes possible for the material contained within the vial of "Probable beta-1,3-galactosyltransferase 20 (B3GALT20), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
