Transmembrane protein 233 (Tmem233) Recombinant Protein | Tmem233 recombinant protein
Recombinant Mouse Transmembrane protein 233 (Tmem233)
Gene Names
Tmem233; DSPB2; Gm13843; OTTMUSG00000014722
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protein 233 (Tmem233); Recombinant Mouse Transmembrane protein 233 (Tmem233); Recombinant Transmembrane protein 233 (Tmem233); Transmembrane protein 233; Tmem233 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-110
Sequence
MSQYASRSDSKGALDSSSPEAYTEDDKTEEDIPAPSNYLWLTIISCFCPAYPVNIVALVFSIMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLVIIGVSCAVHFSRNP
Sequence Length
135
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,997 Da
NCBI Official Full Name
transmembrane protein 233
NCBI Official Synonym Full Names
transmembrane protein 233
NCBI Official Symbol
Tmem233
NCBI Official Synonym Symbols
DSPB2; Gm13843; OTTMUSG00000014722
NCBI Protein Information
transmembrane protein 233; dispanin subfamily B member 2
UniProt Protein Name
Transmembrane protein 233
Protein Family
UniProt Gene Name
Tmem233
UniProt Synonym Gene Names
DSPB2
UniProt Entry Name
TM233_MOUSE
Uniprot Description
TMEM233: Belongs to the CD225/Dispanin family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: membrane; integral to membrane
Biological Process: response to biotic stimulus
Similar Products
Product Notes
The Tmem233 tmem233 (Catalog #AAA1255961) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-110. The amino acid sequence is listed below: MSQYASRSDS KGALDSSSPE AYTEDDKTEE DIPAPSNYLW LTIISCFCPA YPVNIVALVF SIMSLNSYND GDYEGARRLG RNAKWVAIAS IIIGLVIIGV SCAVHFSRNP. It is sometimes possible for the material contained within the vial of "Transmembrane protein 233 (Tmem233), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
