Probable RNA-binding protein (US11) Recombinant Protein | US11 recombinant protein

Recombinant Human herpesvirus 2 Probable RNA-binding protein (US11)

Cat. Num. AAA1255103

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable RNA-binding protein (US11); Recombinant Human herpesvirus 2 Probable RNA-binding protein (US11); US11 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-151, Full length protein
• Sequence: MASGVSPAHPQTPVGAGSRDLSLKGTPSDGMQPRGADTLEGHSLPTDGPPHRGGDHDPAAGKRGDSGLLRVCAALSIPKPSEAVRPSRIPRAPRVPREPRVPREPREPRVPRSPREPRVPRIPRDPRPPRPPRVPREPRPPREPRATRGLA
• Sequence Length: 151

• Species: Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 820945224
• NCBI GeneID: 1487352
• NCBI Accession #: YP_009137224.1
• NCBI GenBank Nucleotide #: NC_001798.2
• UniProt Accession #: P89479
• Molecular Weight: 16,298 Da
• NCBI Official Full Name: tegument protein US11
• NCBI Official Symbol: US11
• NCBI Protein Information: dsRNA-binding protein; antagonizes PKR; inhibits stress-induced translational arrest; involved in translational regulation
• UniProt Protein Name: Probable RNA-binding protein
• Protein Family: Probable RNA-binding protein
• UniProt Gene Name: US11

Uniprot Description

Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA.