WD repeat and SOCS box-containing protein 1 (Wsb1) Recombinant Protein | Wsb1 recombinant protein
Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)
Gene Names
Wsb1; 1110056B13Rik; 2700038M07Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
WD repeat and SOCS box-containing protein 1 (Wsb1); Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1); Wsb1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-421, Full length protein
Sequence
MASFPPRVNEKEIVRSRTIGELLAPAAPFDKKCGGENWTVAFAPDGSYFAWSQGYRIVKLVPWSQCRKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPPEHVIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHIEMVRDLTFAPDGSLLLVSASRDKTLRVWDLKDDGNMVKVLRAHQNWVYSCAFSPDCSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYVWDPHNGDLLMEFGHLFPSPTPIFAGGANDRWVRAVSFSHDGLHVASLADDKMVRFWRIDEDCPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHICRMSIRRVMSTQEVQKLPVPSKILAFLSYRG
Sequence Length
421
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Wsb1 recombinant protein
This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,065 Da
NCBI Official Full Name
WD repeat and SOCS box-containing protein 1 isoform 1
NCBI Official Synonym Full Names
WD repeat and SOCS box-containing 1
NCBI Official Symbol
Wsb1
NCBI Official Synonym Symbols
1110056B13Rik; 2700038M07Rik
NCBI Protein Information
WD repeat and SOCS box-containing protein 1
UniProt Protein Name
WD repeat and SOCS box-containing protein 1
Protein Family
UniProt Gene Name
Wsb1
UniProt Synonym Gene Names
WSB-1
Uniprot Description
Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes type II iodothyronine deiodinase/DIO2. Confers constitutive instability to HIPK2 through proteasomal degradation ().
Research Articles on Wsb1
Similar Products
Product Notes
The Wsb1 wsb1 (Catalog #AAA1254860) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-421, Full length protein. The amino acid sequence is listed below: MASFPPRVNE KEIVRSRTIG ELLAPAAPFD KKCGGENWTV AFAPDGSYFA WSQGYRIVKL VPWSQCRKNF LLHGSKNVTN SSCLKLARQN SNGGQKNKPP EHVIDCGDIV WSLAFGSSVP EKQSRCVNIE WHRFRFGQDQ LLLATGLNNG RIKIWDVYTG KLLLNLVDHI EMVRDLTFAP DGSLLLVSAS RDKTLRVWDL KDDGNMVKVL RAHQNWVYSC AFSPDCSMLC SVGASKAVFL WNMDKYTMIR KLEGHHHDVV ACDFSPDGAL LATASYDTRV YVWDPHNGDL LMEFGHLFPS PTPIFAGGAN DRWVRAVSFS HDGLHVASLA DDKMVRFWRI DEDCPVQVAP LSNGLCCAFS TDGSVLAAGT HDGSVYFWAT PRQVPSLQHI CRMSIRRVMS TQEVQKLPVP SKILAFLSYR G. It is sometimes possible for the material contained within the vial of "WD repeat and SOCS box-containing protein 1 (Wsb1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
