NAC domain-containing protein 29 (NAC029) Recombinant Protein | NAC029 recombinant protein

Recombinant Arabidopsis thaliana NAC domain-containing protein 29 (NAC029)

Cat. Num. AAA1253984

• Gene Names: NAP; activated by AP3/PI; ACTIVATED BY AP3/PI; ANAC029; Arabidopsis NAC domain containing protein 29; ATNAP; F10D13.14; F10D13_14; NAC-like; NAC-LIKE
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: NAC domain-containing protein 29 (NAC029); Recombinant Arabidopsis thaliana NAC domain-containing protein 29 (NAC029); NAC029 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-268, Full length protein
• Sequence: MEVTSQSTLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPPKGIKTDWIMHEYRLHDSRKASTKRNGSMRLDEWVLCRIYKKRGASKLLNEQEGFMDEVLMEDETKVVVNEAERRTEEEIMMMTSMKLPRTCSLAHLLEMDYMGPVSHIDNFSQFDHLHQPDSESSWFGDLQFNQDEILNHHRQAMFKF
• Sequence Length: 268

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 18409291
• NCBI GeneID: 843282
• NCBI Accession #: NP_564966.1
• NCBI GenBank Nucleotide #: NM_105616.4
• UniProt Accession #: O49255; Q8LD99
• Molecular Weight: 31,426 Da
• NCBI Official Full Name: NAC-like, activated by AP3/PI
• NCBI Official Symbol: NAP
• NCBI Official Synonym Symbols: activated by AP3/PI; ACTIVATED BY AP3/PI; ANAC029; Arabidopsis NAC domain containing protein 29; ATNAP; F10D13.14; F10D13_14; NAC-like; NAC-LIKE
• NCBI Protein Information: NAC-like, activated by AP3/PI
• UniProt Protein Name: NAC transcription factor 29
• Protein Family: NAC transcription factor
• UniProt Gene Name: NAC029
• UniProt Synonym Gene Names: ANAC029; NAC29; NAP; AtNAC029; AtNAP

NCBI Description

Encodes a member of the NAC transcription factor gene family. It is expressed in floral primordia and upregulated by AP3 and PI. Its expression is associated with leaf senescence.

Uniprot Description

Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494).