Potassium voltage-gated channel subfamily E member 2 Recombinant Protein | Kcne2 recombinant protein

Recombinant Rat Potassium voltage-gated channel subfamily E member 2

Cat. Num. AAA1253811

• Gene Names: Kcne2; Mirp1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Potassium voltage-gated channel subfamily E member 2; Recombinant Rat Potassium voltage-gated channel subfamily E member 2; MinK-related peptide 1; Minimum potassium ion channel-related peptide 1; Potassium channel subunit beta MiRP1; Kcne2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-123aa; Full Length
• Sequence: MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
• Sequence Length: 123

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Kcne2 recombinant protein

Ancillary protein that assbles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with KCNQ1/KCLQT1 and elicit a voltage-independent current.

References

MiRP1 forms IKr potassium channels with HERG and is associated with cardiac arrhythmia.Abbott G.W., Sesti F., Splawski I., Buck M.E., Lehmann M.H., Timothy K.W., Keating M.T., Goldstein S.A.N.Cell 97:175-187(1999) MinK-related peptide 1 a beta subunit for the HCN ion channel subunit family enhances expression and speeds activation.Yu H., Wu J., Potapova I., Wymore R.T., Holmes B., Zuckerman J., Pan Z., Wang H., Shi W., Robinson R.B., El-Maghrabi M.R., Benjamin W., Dixon J.E., McKinnon D., Cohen I.S., Wymore R.Circ. Res. 88:E84-E87(2001)

NCBI and Uniprot Product Information

• NCBI GI #: 19424314
• NCBI GeneID: 171138
• NCBI Accession #: NP_598287.1
• NCBI GenBank Nucleotide #: NM_133603.2
• UniProt Accession #: P63161; Q5FVT9; Q9WTW0
• Molecular Weight: 18.4 kDa
• NCBI Official Full Name: potassium voltage-gated channel subfamily E member 2
• NCBI Official Synonym Full Names: potassium voltage-gated channel subfamily E regulatory subunit 2
• NCBI Official Symbol: Kcne2
• NCBI Official Synonym Symbols: Mirp1
• NCBI Protein Information: potassium voltage-gated channel subfamily E member 2
• UniProt Protein Name: Potassium voltage-gated channel subfamily E member 2
• Protein Family: Potassium voltage-gated channel subfamily
• UniProt Gene Name: Kcne2
• UniProt Entry Name: KCNE2_RAT

NCBI Description

small integral membrane subunit which binds with HERG, a pore-forming protein, to alter its channel function [RGD, Feb 2006]

Uniprot Description

KCNE2: Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with KCNQ1/KVLTQ1 and elicit a voltage-independent current. May associate with HCN1 and HCN2 and increase potassium current. Defects in KCNE2 are the cause of long QT syndrome type 6 (LQT6). Long QT syndromes are heart disorders characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to exercise or emotional stress. KCNE2 mutants form channels that open slowly and close rapidly, thereby diminishing potassium currents. Defects in KCNE2 are the cause of familial atrial fibrillation type 4 (ATFB4). Atrial fibrillation is a common disorder of cardiac rhythm that is hereditary in a small subgroup of patients. It is characterized by disorganized atrial electrical activity and ineffective atrial contraction promoting blood stasis in the atria and reduces ventricular filling. It can result in palpitations, syncope, thromboembolic stroke, and congestive heart failure. Belongs to the potassium channel KCNE family.

Protein type: Membrane protein, integral

Cellular Component: cell surface; integral to membrane; lysosome; membrane; plasma membrane; voltage-gated potassium channel complex

Molecular Function: cation channel activity; delayed rectifier potassium channel activity; inward rectifier potassium channel activity; potassium channel regulator activity; protein binding; protein homodimerization activity; voltage-gated potassium channel activity

Biological Process: aging; potassium ion import; tongue development