Histone-lysine N-methyltransferase, H3 lysine-9, H3 lysine-27, H4 lysine-20 and cytosine specific SUVH2 (SUVH2) Recombinant Protein | SUVH2 recombinant protein

Recombinant Arabidopsis thaliana Histone-lysine N-methyltransferase, H3 lysine-9, H3 lysine-27, H4 lysine-20 and cytosine specific SUVH2 (SUVH2) , partial

Cat. Num. AAA1251773

• Gene Names: SUVH2; ATSUVH2; F4P9.6; F4P9_6; SDG3; SET DOMAIN-CONTAINING PROTEIN 3; SU(VAR)3-9 homolog 2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Histone-lysine N-methyltransferase; H3 lysine-9; H3 lysine-27; H4 lysine-20 and cytosine specific SUVH2 (SUVH2); Recombinant Arabidopsis thaliana Histone-lysine N-methyltransferase; partial; SUVH2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 434-638. Partial, including the Pre-SET domain and SET domain
• Sequence: TGCECKLSCTDDCLCARKNGGEFAYDDNGHLLKGKHVVFECGEFCTCGPSCKSRVTQKGLRNRLEVFRSKETGWGVRTLDLIEAGAFICEYAGVVVTRLQAEILSMNGDVMVYPGRFTDQWRNWGDLSQVYPDFVRPNYPSLPPLDFSMDVSRMRNVACYISHSKEPNVMVQFVLHDHNHLMFPRVMLFALENISPLAELSLDYG
• Sequence Length: 638

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 1063702149
• NCBI GeneID: 817892
• NCBI Accession #: NP_001318341.1
• NCBI GenBank Nucleotide #: NM_001336444.1
• UniProt Accession #: O22781
• Molecular Weight: 72,848 Da
• NCBI Official Full Name: SU(VAR)3-9 homolog 2
• NCBI Official Symbol: SUVH2
• NCBI Official Synonym Symbols: ATSUVH2; F4P9.6; F4P9_6; SDG3; SET DOMAIN-CONTAINING PROTEIN 3; SU(VAR)3-9 homolog 2
• NCBI Protein Information: SU(VAR)3-9 homolog 2
• UniProt Protein Name: Histone-lysine N-methyltransferase family member SUVH2
• Protein Family: Histone-lysine N-methyltransferase family
• UniProt Gene Name: SUVH2
• UniProt Synonym Gene Names: SDG3; SET3; H3-K9-HMTase 2; Su(var)3-9 homolog protein 2

NCBI Description

Encodes a SU(VAR)3-9 homolog, a SET domain protein. Known SET domain proteins are involved in epigenetic control of gene expression and act as histone methyltransferases. There are 10 SUVH genes in Arabidopsis and members of this subfamily of the SET proteins have an additional conserved SRA domain. Gene is expressed in rosettes, stems, floral buds, and flowers by RT-PCR.

Uniprot Description

Histone methyltransferase family member that plays a central role in gene silencing (PubMed:15775980, PubMed:16384625, PubMed:19043555, PubMed:24463519, PubMed:27171427). Together with MORC6 and SUVH9, regulates the silencing of some transposable elements (TEs) (PubMed:27171427). According to PubMed:15775980, it is required for normal methylation of 'Lys-9' and 'Lys-27' of histone H3, 'Lys-20' of H4, and cytosine, but PubMed:19043555 see no significant effect on histone methylation when the gene is mutated. According to PubMed:19043555, the protein does not bind S-adenosyl-L-methionine and lacks methyltransferase activity. Instead, it may function downstream of DRM2 in RNA-directed DNA methylation, binding to methylated DNA and recruiting DNA-directed RNA polymerase V to chromatin (PubMed:24463519, PubMed:27171427).