Auxin-responsive protein IAA20 (IAA20) Recombinant Protein | IAA20 recombinant protein

Recombinant Arabidopsis thaliana Auxin-responsive protein IAA20 (IAA20)

Cat. Num. AAA1250740

• Gene Names: IAA20; F14M4.18; indole-3-acetic acid inducible 20
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Auxin-responsive protein IAA20 (IAA20); Recombinant Arabidopsis thaliana Auxin-responsive protein IAA20 (IAA20); IAA20 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-175, Full length protein
• Sequence: MGRGRSSSSSSIESSSKSNPFGASSSTRNLSTDLRLGLSFGTSSGTQYFNGGYGYSVAAPAVEDAEYVAAVEEEEENECNSVGSFYVKVNMEGVPIGRKIDLMSLNGYRDLIRTLDFMFNASILWAEEEDMCNEKSHVLTYADKEGDWMMVGDVPWEMFLSTVRRLKISRANYHY
• Sequence Length: 175

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 15226476
• NCBI GeneID: 819313
• NCBI Accession #: NP_182222.1
• NCBI GenBank Nucleotide #: NM_130267.6
• UniProt Accession #: O24410
• Molecular Weight: 19,445 Da
• NCBI Official Full Name: indole-3-acetic acid inducible 20
• NCBI Official Symbol: IAA20
• NCBI Official Synonym Symbols: F14M4.18; indole-3-acetic acid inducible 20
• NCBI Protein Information: indole-3-acetic acid inducible 20
• UniProt Protein Name: Auxin-responsive protein IAA20
• Protein Family: Auxin-responsive protein
• UniProt Gene Name: IAA20

NCBI Description

Encodes a member of the Aux/IAA family of proteins implicated in auxin signaling. IAA20 lacks the conserved degron (domain II) found in many family members, and IAA20 fusion proteins are stable in Arabidopsis seedlings. IAA20 transcripts are induced by auxin treatment, and overexpression of IAA20 leads to defects in gravitropism, root development, root meristem maintenance, etiolation, and cotyledon vascular development.

Uniprot Description

Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.