Phosphatidylglycerol phospholipase C (SPAC4D7.02c) Recombinant Protein | SPAC4D7.02c recombinant protein
Recombinant Schizosaccharomyces pombe Phosphatidylglycerol phospholipase C (SPAC4D7.02c)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidylglycerol phospholipase C (SPAC4D7.02c); Recombinant Schizosaccharomyces pombe Phosphatidylglycerol phospholipase C (SPAC4D7.02c); Recombinant Phosphatidylglycerol phospholipase C (SPAC4D7.02c); Phosphatidylglycerol phospholipase C EC= 3.1.4.-; SPAC4D7.02c recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-311
Sequence
MAFNYSIANTVDDAAQSIAENTSSLATFSKPPLVIAHRGYKAKYPENTILAFQQAVKAGADCVETDVRLTKDEVVCILHDRNLNRVFGVDVDVRDLDYELDNGHFRTIQEPHEPLPTYEQFLHELTKHPGVNLLVDIKPVNDLLIIPRMVDAMLRVNSDLDFWKDKVSFCLWSHRFIPACDRYAPSIPLYHIGFNFAYAERHFVMHPRVKGVSMAVALFLLPHSQDFVDLVHAQGKQVFAWTLNTPSSIYLALIRGCDGLLSDDPVMARALSQGPIVTKSWHYFHYSEWLHMIYGFLRAQFVFFLLRTFVL
Sequence Length
311
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
35,585 Da
NCBI Official Full Name
Phosphatidylglycerol phospholipase C
NCBI Official Symbol
SPAC4D7.02c
NCBI Protein Information
glycerophosphoryl diester phosphodiesterase (predicted)
UniProt Protein Name
Phosphatidylglycerol phospholipase C
Protein Family
UniProt Entry Name
PGC1_SCHPO
Uniprot Description
Function: Phosphatidylglycerol phospholipase required for the removal of excess phosphatidylglycerol (PG) via a phospholipase C-type degradation mechanism
By similarity.
Subcellular location: Mitochondrion membrane
By similarity; Single-pass type IV membrane protein
Potential.
Sequence similarities: Belongs to the glycerophosphoryl diester phosphodiesterase family.Contains 1 GDPD domain.
Similar Products
Product Notes
The SPAC4D7.02c (Catalog #AAA1246648) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-311. The amino acid sequence is listed below: MAFNYSIANT VDDAAQSIAE NTSSLATFSK PPLVIAHRGY KAKYPENTIL AFQQAVKAGA DCVETDVRLT KDEVVCILHD RNLNRVFGVD VDVRDLDYEL DNGHFRTIQE PHEPLPTYEQ FLHELTKHPG VNLLVDIKPV NDLLIIPRMV DAMLRVNSDL DFWKDKVSFC LWSHRFIPAC DRYAPSIPLY HIGFNFAYAE RHFVMHPRVK GVSMAVALFL LPHSQDFVDL VHAQGKQVFA WTLNTPSSIY LALIRGCDGL LSDDPVMARA LSQGPIVTKS WHYFHYSEWL HMIYGFLRAQ FVFFLLRTFV L. It is sometimes possible for the material contained within the vial of "Phosphatidylglycerol phospholipase C (SPAC4D7.02c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
