Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

G-protein coupled receptor Mth (mth) Recombinant Protein | mth recombinant protein

Recombinant Drosophila melanogaster G-protein coupled receptor Mth (mth)

Gene Names
mth; CG6936; DmelCG6936; Mth; MTH
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G-protein coupled receptor Mth (mth); Recombinant Drosophila melanogaster G-protein coupled receptor Mth (mth); Recombinant G-protein coupled receptor Mth (mth); G-protein coupled receptor Mth; Protein methuselah; mth recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-514
Sequence
DILECDYFDTVDISAAQKLQNGSYLFEGLLVPAILTGEYDFRILPDDSKQKVARHIRGCVCKLKPCVRFCCPHDHIMDNGVCYDNMSDEELAELDPFLNVTLDDGSVSRRHFKNELIVQWDLPMPCDGMFYLDNREEQDKYTLFENGTFFRHFDRVTLRKREYCLQHLTFADGNATSIRIAPHNCLIVPSITGQTVVMISSLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFLLLDLWQISISFCKPAGFLGYFFVMAAFFWLSVISLHLWNTFRGSSHKANRFLFEHRFLAYNTYAWGMAVVLTGITVLADNIVENQDWNPRVGHEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTAKRILGVKKDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYFSQSNQTWANVFLVADYLNWSQGIIIFILFVLKRSTWRLLQESIRGEGEEVNNSEEEISLENTTTRNVLL
Sequence Length
514
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
59,644 Da
NCBI Official Full Name
methuselah, isoform C
NCBI Official Synonym Full Names
methuselah
NCBI Official Symbol
mth
NCBI Official Synonym Symbols
CG6936; DmelCG6936; Mth; MTH
NCBI Protein Information
CG6936 gene product from transcript CG6936-RE; CG6936-PA; CG6936-PB; CG6936-PC; CG6936-PD; CG6936-PE; methusalah; methuselah; mth-PA; mth-PB; mth-PC; mth-PD; mth-PE
UniProt Protein Name
G-protein coupled receptor Mth
UniProt Gene Name
mth
UniProt Entry Name
MTH_DROME

Uniprot Description

Function: Involved in biological aging and stress response. Essential for adult survival. Required in the presynaptic motor neuron to up-regulate neurotransmitter exocytosis at larval glutamatergic neuromuscular junctions (NMJs). Regulates a step associated with docking and clustering of vesicles at release sites. Sun, Acp70A/SP and eys/SPAM are agonists that activate mth. Ref.1 Ref.7

Subunit structure: Homodimer. Interacts with sun, Acp70A/SP and eys/SPAM. Ref.8 Ref.9

Subcellular location: Cell membrane; Multi-pass membrane protein. Note: Plasma membrane of presynaptic terminals and innervating axons. Ref.7

Disruption phenotype: Increase in average life-span and enhanced resistance to various forms of stress, including starvation, high temperature and dietary paraquat, a free-radical generator. Ref.1

Miscellaneous: Agonists of mth share minimal sequence homology, suggesting a remarkable promiscuity of mth for activation.

Sequence similarities: Belongs to the G-protein coupled receptor 2 family. Mth subfamily.

Sequence caution: The sequence AAG22708.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22709.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22710.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22711.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22712.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22713.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22714.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22715.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22716.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22717.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22718.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22719.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22720.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22721.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22722.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22723.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22724.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22725.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22726.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22727.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22728.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22729.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22730.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22731.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22732.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22733.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22734.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22735.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22736.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22737.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22738.1 differs from that shown. Reason: Erroneous gene model prediction.

Research Articles on mth

Similar Products

Product Notes

The mth mth (Catalog #AAA1241271) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-514. The amino acid sequence is listed below: DILECDYFDT VDISAAQKLQ NGSYLFEGLL VPAILTGEYD FRILPDDSKQ KVARHIRGCV CKLKPCVRFC CPHDHIMDNG VCYDNMSDEE LAELDPFLNV TLDDGSVSRR HFKNELIVQW DLPMPCDGMF YLDNREEQDK YTLFENGTFF RHFDRVTLRK REYCLQHLTF ADGNATSIRI APHNCLIVPS ITGQTVVMIS SLICMVLTIA VYLFVKKLQN LHGKCFICYM VCLFMGYLFL LLDLWQISIS FCKPAGFLGY FFVMAAFFWL SVISLHLWNT FRGSSHKANR FLFEHRFLAY NTYAWGMAVV LTGITVLADN IVENQDWNPR VGHEGHCWIY TQAWSAMLYF YGPMVFLIAF NITMFILTAK RILGVKKDIQ NFAHRQERKQ KLNSDKQTYT FFLRLFIIMG LSWSLEIGSY FSQSNQTWAN VFLVADYLNW SQGIIIFILF VLKRSTWRLL QESIRGEGEE VNNSEEEISL ENTTTRNVLL. It is sometimes possible for the material contained within the vial of "G-protein coupled receptor Mth (mth), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.