Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Intron-encoded DNA endonuclease I-AniI (I-AniI), partial Recombinant Protein | I-AniI recombinant protein

Recombinant Emericella nidulans Intron-encoded DNA endonuclease I-AniI (I-AniI), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intron-encoded DNA endonuclease I-AniI (I-AniI); partial; Recombinant Emericella nidulans Intron-encoded DNA endonuclease I-AniI (I-AniI); Intron-encoded DNA endonuclease I-AniI; COB intron protein; mRNA maturase bI1Cleaved into the following 2 chains:; 1. Truncated non-functional cytochrome b; 2. DNA endonuclease/RNA maturase I-AniI; EC=3. 3.1.-.-; I-AniI recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-488; Full length
Sequence
MRILKSHPLLKIVNSYIIDSPQPANLSYLWNFGSLLALCLGIQIVTGVTLAMHYTPSVSEAF NSVEHIMRDVNNGWLVRYLHSNTASAFFFLVYLHIGRGLYYGSYKTPRTLTWAIGTVILIV MMATAFLGYVLPYGQMSLWGATVITNLMSAIPWIGQDIVEFIWGGLYTDEPQCGDVLLK ILLNAGKSPILGFAYDLFFIIVLLIGVKIAMTRGKSAGVRSLHTSEASQRLHAGDLTYAYLV GLFEGDGYFSITKKGKYLTYELGIELSIKDVQLIYKIKKILGIGIVSFRKINEIEMVALRIRDK NHLKSFILPIFEKYPMFSNKQYDYLRFRNALLSGIISLEDLPDYTRSDEPLNSIESIINTSYF SAWLVGFIEAEGCFSVYKLNKDDDYLIASFDIAQRDGDILISAIRKYLSFTTKVYLDKTNC SKLKVTSVRSVENIIKFLQNAPVKLLGNKKLQYLLWLKQLRKISRYSEKIKIPSNY
Sequence Length
488
Species
Emericella nidulans (Aspergillus nidulans)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
55,395 Da
NCBI Official Full Name
Intron-encoded DNA endonuclease I-AniI
UniProt Protein Name
Intron-encoded DNA endonuclease I-AniI
UniProt Gene Name
I-AniI
UniProt Entry Name
ANI1_EMEND

Uniprot Description

Mitochondrial DNA endonuclease and mRNA maturase involved in intron homing and required for splicing of the cytochrome b (cobA) gene intron, containing its own coding sequence. The protein stimulates the intrinsic ribozyme activity of the intron through binding to and stabilizing specific secondary and tertiary structure elements in the RNA. As an endonuclease it introduces a specific double-strand break at the junction of the two exons the cobA gene and thus mediates the insertion of an intron, containing its own coding sequence (group I intron), into an intronless gene. Recognizes with limited specificity and cleaves the sequence 5'-GAGGAGGTTTCTCTGTA-3'. The proteins RNA and DNA recognition and binding surfaces are independent.

Similar Products

Product Notes

The I-AniI i-anii (Catalog #AAA1240419) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-488; Full length. The amino acid sequence is listed below: MRILKSHPLL KIVNSYIIDS PQPANLSYLW NFGSLLALCL GIQIVTGVTL AMHYTPSVSE AF NSVEHIMRDV NNGWLVRYLH SNTASAFFFL VYLHIGRGLY YGSYKTPRTL TWAIGTVILI V MMATAFLGYV LPYGQMSLWG ATVITNLMSA IPWIGQDIVE FIWGGLYTDE PQCGDVLLK ILLNAGKSPI LGFAYDLFFI IVLLIGVKIA MTRGKSAGVR SLHTSEASQR LHAGDLTYAY LV GLFEGDGYFS ITKKGKYLTY ELGIELSIKD VQLIYKIKKI LGIGIVSFRK INEIEMVALR IRDK NHLKSFILPI FEKYPMFSNK QYDYLRFRNA LLSGIISLED LPDYTRSDEP LNSIESIINT SYF SAWLVGFIEA EGCFSVYKLN KDDDYLIASF DIAQRDGDIL ISAIRKYLSF TTKVYLDKTN C SKLKVTSVRS VENIIKFLQN APVKLLGNKK LQYLLWLKQL RKISRYSEKI KIPSNY. It is sometimes possible for the material contained within the vial of "Intron-encoded DNA endonuclease I-AniI (I-AniI), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.