Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Cobalt transport protein CbiN (cbiN) Recombinant Protein | MmarC7_0726 recombinant protein

Recombinant Methanococcus maripaludis Cobalt transport protein CbiN (cbiN)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cobalt transport protein CbiN (cbiN); Recombinant Methanococcus maripaludis Cobalt transport protein CbiN (cbiN); Recombinant Cobalt transport protein CbiN (cbiN); Cobalt transport protein CbiN; Energy-coupling factor transporter probable substrate-capture protein CbiN; ECF transporter S component CbiN; MmarC7_0726 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-97
Sequence
MEFKHVLMILGVIILTLAPLIMYSGLGEDEGYFGGADGAAGDLIMEISPNYEPWFEPFWEPPSGEIESLLFALQAAIGALIIGYFFGYNKAKYDDQN
Sequence Length
97
Species
Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,713 Da
NCBI Official Full Name
cobalt transport protein CbiN
NCBI Official Symbol
MmarC7_0726
NCBI Protein Information
cobalt transport protein CbiN
UniProt Protein Name
Cobalt transport protein CbiN
UniProt Gene Name
cbiN
UniProt Synonym Gene Names
ECF transporter S component CbiN
UniProt Entry Name
CBIN_METM7

Uniprot Description

Function: Part of the energy-coupling factor (ECF) transporter complex CbiMNOQ involved in cobalt import

By similarity. HAMAP-Rule MF_00330

Pathway: Cofactor biosynthesis; adenosylcobalamin biosynthesis. HAMAP-Rule MF_00330

Subunit structure: Forms an energy-coupling factor (ECF) transporter complex composed of an ATP-binding protein (A component, CbiO), a transmembrane protein (T component, CbiQ) and 2 possible substrate-capture proteins (S components, CbiM and CbiN) of unknown stoichimetry

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity HAMAP-Rule MF_00330.

Sequence similarities: Belongs to the CbiN family.

Similar Products

Product Notes

The MmarC7_0726 cbin (Catalog #AAA1237971) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-97. The amino acid sequence is listed below: MEFKHVLMIL GVIILTLAPL IMYSGLGEDE GYFGGADGAA GDLIMEISPN YEPWFEPFWE PPSGEIESLL FALQAAIGAL IIGYFFGYNK AKYDDQN. It is sometimes possible for the material contained within the vial of "Cobalt transport protein CbiN (cbiN), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual