Probable tRNA-splicing endonuclease subunit sen34 (sen34) Recombinant Protein | sen34 recombinant protein
Recombinant Schizosaccharomyces pombe Probable tRNA-splicing endonuclease subunit sen34 (sen34)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable tRNA-splicing endonuclease subunit sen34 (sen34); Recombinant Schizosaccharomyces pombe Probable tRNA-splicing endonuclease subunit sen34 (sen34); sen34 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-284, Full length
Sequence
MEDEKFPISYVHGKFLVFDVQAVEVFRKNYHILGTLVGTLPQLPQQNVFLGLPMELSKEEAFYLIEKGISYIVDDTKVHKQLLENTTKDDVKQCLKKRQSLAYDQMIAAKKKENEKKIEIMKKLGRTLPLDPLNYDEHDSFDLSWIPVDTVTTRIAEKSSMNDDFHKEEDVFENLDINRYLMFKSLVDTGFYLNPGLRFGCQFVAYPGDALRYHSHYLVNSYKWDQEIPVLFLIGGGRLGTAVKKTWLIGGSNDRNINMNGEKSKEELLLLPVRHFSIEWAGFG
Sequence Length
284
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,808 Da
NCBI Official Full Name
tRNA-splicing endonuclease catalytic subunit Sen34 (predicted)
NCBI Official Symbol
sen34
NCBI Protein Information
tRNA-splicing endonuclease catalytic subunit Sen34 (predicted)
UniProt Protein Name
Probable tRNA-splicing endonuclease subunit sen34
Protein Family
UniProt Gene Name
sen34
Uniprot Description
Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. It probably carries the active site for 3'-splice site cleavage ().
Similar Products
Product Notes
The sen34 sen34 (Catalog #AAA1236575) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-284, Full length. The amino acid sequence is listed below: MEDEKFPISY VHGKFLVFDV QAVEVFRKNY HILGTLVGTL PQLPQQNVFL GLPMELSKEE AFYLIEKGIS YIVDDTKVHK QLLENTTKDD VKQCLKKRQS LAYDQMIAAK KKENEKKIEI MKKLGRTLPL DPLNYDEHDS FDLSWIPVDT VTTRIAEKSS MNDDFHKEED VFENLDINRY LMFKSLVDTG FYLNPGLRFG CQFVAYPGDA LRYHSHYLVN SYKWDQEIPV LFLIGGGRLG TAVKKTWLIG GSNDRNINMN GEKSKEELLL LPVRHFSIEW AGFG. It is sometimes possible for the material contained within the vial of "Probable tRNA-splicing endonuclease subunit sen34 (sen34), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
