Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cystathionine beta-synthase (Cbs) Recombinant Protein | Cbs recombinant protein

Recombinant Rat Cystathionine beta-synthase (Cbs)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cystathionine beta-synthase (Cbs); Recombinant Rat Cystathionine beta-synthase (Cbs); Cbs recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-561, full length protein
Sequence
PSGTSQCEDGSAGCPQDLEVQPEKGQLEKGASGDKERVWISPDTPSRCTWQLGRPMADSPHYHTVPTKSPKILPDILRKIGNTPMVRINRISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGTLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKVDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDRWFKSNDDDSFAFARMLISQEGLLCGGSSGSAMAVAVKAAQELKEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWHLRVQELSLSAPLTVLPTVTCEHTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGMLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDRNNGVSSKQLMVFGVVTAIDLLNFVAAREQTRK
Sequence Length
560
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cbs recombinant protein
This protein acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,513 Da
NCBI Official Full Name
cystathionine beta-synthase
NCBI Official Synonym Full Names
cystathionine beta synthase
NCBI Official Symbol
Cbs
NCBI Protein Information
cystathionine beta-synthase
UniProt Protein Name
Cystathionine beta-synthase
UniProt Gene Name
Cbs

NCBI Description

catalyzes condensation of serine and homocyteine to cystathione; involved in transsulfuration pathway; regulated by insulin; alternative splicing produces four mRNA species [RGD, Feb 2006]

Uniprot Description

Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine (). Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons (PubMed:20149843, PubMed:8558235).

Research Articles on Cbs

Similar Products

Product Notes

The Cbs cbs (Catalog #AAA1236288) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-561, full length protein. The amino acid sequence is listed below: PSGTSQCEDG SAGCPQDLEV QPEKGQLEKG ASGDKERVWI SPDTPSRCTW QLGRPMADSP HYHTVPTKSP KILPDILRKI GNTPMVRINR ISKNAGLKCE LLAKCEFFNA GGSVKDRISL RMIEDAERAG TLKPGDTIIE PTSGNTGIGL ALAAAVKGYR CIIVMPEKMS MEKVDVLRAL GAEIVRTPTN ARFDSPESHV GVAWRLKNEI PNSHILDQYR NASNPLAHYD DTAEEILQQC DGKVDMLVAS AGTGGTITGI ARKLKEKCPG CKIIGVDPEG SILAEPEELN QTEQTAYEVE GIGYDFIPTV LDRAVVDRWF KSNDDDSFAF ARMLISQEGL LCGGSSGSAM AVAVKAAQEL KEGQRCVVIL PDSVRNYMSK FLSDKWMLQK GFMKEELSVK RPWWWHLRVQ ELSLSAPLTV LPTVTCEHTI AILREKGFDQ APVVNESGAI LGMVTLGNML SSLLAGKVRP SDEVCKVLYK QFKPIHLTDT LGMLSHILEM DHFALVVHEQ IQSRDQAWSG VVGGPTDRNN GVSSKQLMVF GVVTAIDLLN FVAAREQTRK. It is sometimes possible for the material contained within the vial of "Cystathionine beta-synthase (Cbs), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.