Nitrogen regulation protein NR (II) Recombinant Protein | glnL recombinant protein
Recombinant Escherichia coli Nitrogen regulation protein NR (II)
Gene Names
glnL; ECK3862; glnR; JW3840; ntrB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nitrogen regulation protein NR (II); Recombinant Escherichia coli Nitrogen regulation protein NR (II); glnL recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-349, full length protein
Sequence
MATGTQPDAGQILNSLINSILLIDDNLAIHYANPAAQQLLAQSSRKLFGTPLPELLSYFSLNIELMQESLEAGQGFTDNEVTLVIDGRSHILSVTAQRMPDGMILLEMAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPSLLEYTKVIIEQADRLRNLVDRLLGPQLPGTRVTESIHKVAERVVTLVSMELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGERYRLAARIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTSWPGHTEFSVYLPIRK
Sequence Length
349
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,556 Da
NCBI Official Full Name
sensory histidine kinase in two-component regulatory system with GlnG
NCBI Official Symbol
glnL
NCBI Official Synonym Symbols
ECK3862; glnR; JW3840; ntrB
NCBI Protein Information
sensory histidine kinase in two-component regulatory system with GlnG
UniProt Protein Name
Sensory histidine kinase/phosphatase NtrB
Protein Family
UniProt Gene Name
glnL
UniProt Synonym Gene Names
NRII
NCBI Description
NtrB belongs to the transmitter-protein family of the conserved two-component system of signal transduction NtrB/NtrC , and is involved in response to limitation of nitrogen . [More information is available at EcoCyc: EG10387].
Uniprot Description
Member of the two-component regulatory system NtrB/NtrC, which controls expression of the nitrogen-regulated (ntr) genes in response to nitrogen limitation. Under conditions of nitrogen limitation, NtrB autophosphorylates and transfers the phosphoryl group to NtrC. In the presence of nitrogen, acts as a phosphatase that dephosphorylates and inactivates NtrC.
Research Articles on glnL
Similar Products
Product Notes
The glnL glnl (Catalog #AAA1227979) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-349, full length protein. The amino acid sequence is listed below: MATGTQPDAG QILNSLINSI LLIDDNLAIH YANPAAQQLL AQSSRKLFGT PLPELLSYFS LNIELMQESL EAGQGFTDNE VTLVIDGRSH ILSVTAQRMP DGMILLEMAP MDNQRRLSQE QLQHAQQVAA RDLVRGLAHE IKNPLGGLRG AAQLLSKALP DPSLLEYTKV IIEQADRLRN LVDRLLGPQL PGTRVTESIH KVAERVVTLV SMELPDNVRL IRDYDPSLPE LAHDPDQIEQ VLLNIVRNAL QALGPEGGEI ILRTRTAFQL TLHGERYRLA ARIDVEDNGP GIPPHLQDTL FYPMVSGREG GTGLGLSIAR NLIDQHSGKI EFTSWPGHTE FSVYLPIRK. It is sometimes possible for the material contained within the vial of "Nitrogen regulation protein NR (II), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
