Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Odorant receptor 23a (Or23a) Recombinant Protein | Or23a recombinant protein

Recombinant Drosophila melanogaster Odorant receptor 23a (Or23a)

Gene Names
Or23a; 23a; 23A.1; AN5; CG9880; DmelCG9880; DOR23A.1; dor64; Dor64; DOR64; Or23A.1; Or64
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Odorant receptor 23a (Or23a); Recombinant Drosophila melanogaster Odorant receptor 23a (Or23a); Recombinant Odorant receptor 23a (Or23a); Odorant receptor 23a; Or23a recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-379
Sequence
MKLSETLKIDYFRVQLNAWRICGALDLSEGRYWSWSMLLCILVYLPTPMLLRGVYSFEDPVENNFSLSLTVTSLSNLMKFCMYVAQLTKMVEVQSLIGQLDARVSGESQSERHRNMTEHLLRMSKLFQITYAVVFIIAAVPFVFETELSLPMPMWFPFDWKNSMVAYIGALVFQEIGYVFQIMQCFAADSFPPLVLYLISEQCQLLILRISEIGYGYKTLEENEQDLVNCIRDQNALYRLLDVTKSLVSYPMMVQFMVIGINIAITLFVLIFYVETLYDRIYYLCFLLGITVQTYPLCYYGTMVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTKRMQLLLAGNLVPIHLSTYVACWKGAYSFFTLMADRDGLGS
Sequence Length
379
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,793 Da
NCBI Official Full Name
odorant receptor 23a
NCBI Official Synonym Full Names
Odorant receptor 23a
NCBI Official Symbol
Or23a
NCBI Official Synonym Symbols
23a; 23A.1; AN5; CG9880; DmelCG9880; DOR23A.1; dor64; Dor64; DOR64; Or23A.1; Or64
NCBI Protein Information
CG9880 gene product from transcript CG9880-RA; CG9880-PA; Or23a-PA; odorant receptor 23a; odorant receptor 64; olfactory receptor 23A.1
UniProt Protein Name
Odorant receptor 23a
Protein Family
UniProt Gene Name
Or23a
UniProt Synonym Gene Names
AN5; DOR23A.1; dor64; Or23A.1
UniProt Entry Name
OR23A_DROME

Uniprot Description

Function: Complexes with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. They are necessary and sufficient to promote functional reconstitution of odor-evoked signaling in sensory neurons that normally respond only to carbon dioxide

By similarity.

Subunit structure: Interacts with Orco. Complexes exist early in the endomembrane system in olfactory sensory neurons (OSNs), coupling these complexes to the conserved ciliary trafficking pathway

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity.

Tissue specificity: Expressed in 10-40 sensory cells in the third antenna segment and in the maxillary palp. Ref.1 Ref.2 Ref.5

Miscellaneous: The atypical heteromeric and topological design of the odorant receptors appears to be an insect-specific solution for odor recognition, making the OR/Orco complex an attractive target for the development of highly selective insect repellents to disrupt olfactory-mediated host-seeking behaviors of insect disease vectors. Odor-evoked OR currents are independent of known G-protein-coupled second messenger pathways.

Sequence similarities: Belongs to the heteromeric odorant receptor channel (TC 1.A.69) family. [View classification]

Research Articles on Or23a

Similar Products

Product Notes

The Or23a or23a (Catalog #AAA1222420) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-379. The amino acid sequence is listed below: MKLSETLKID YFRVQLNAWR ICGALDLSEG RYWSWSMLLC ILVYLPTPML LRGVYSFEDP VENNFSLSLT VTSLSNLMKF CMYVAQLTKM VEVQSLIGQL DARVSGESQS ERHRNMTEHL LRMSKLFQIT YAVVFIIAAV PFVFETELSL PMPMWFPFDW KNSMVAYIGA LVFQEIGYVF QIMQCFAADS FPPLVLYLIS EQCQLLILRI SEIGYGYKTL EENEQDLVNC IRDQNALYRL LDVTKSLVSY PMMVQFMVIG INIAITLFVL IFYVETLYDR IYYLCFLLGI TVQTYPLCYY GTMVQESFAE LHYAVFCSNW VDQSASYRGH MLILAERTKR MQLLLAGNLV PIHLSTYVAC WKGAYSFFTL MADRDGLGS. It is sometimes possible for the material contained within the vial of "Odorant receptor 23a (Or23a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.