Protein phnH (phnH) Recombinant Protein | phnH recombinant protein
Recombinant Escherichia coli Protein phnH (phnH)
Gene Names
phnH; ECK4093; JW4061
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein phnH (phnH); Recombinant Escherichia coli Protein phnH (phnH); phnH recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-194, full length protein
Sequence
MTLETAFMLPVQDAQHSFRRLLKAMSEPGVIVALHQLKRGWQPLNIATTSVLLTLADNDTPVWLSTPLNNDIVNQSLRFHTNAPLVSQPEQATFAVTDEAISSEQLNALSTGTAVAPEAGATLILQVASLSGGRMLRLTGAGIAEERMIAPQLPECILHELTERPHPFPLGIDLILTCGERLLAIPRTTHVEVC
Sequence Length
194
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,027 Da
NCBI Official Full Name
ribophosphonate triphosphate synthase subunit
NCBI Official Symbol
phnH
NCBI Official Synonym Symbols
ECK4093; JW4061
NCBI Protein Information
ribophosphonate triphosphate synthase subunit
UniProt Protein Name
Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH
Protein Family
UniProt Gene Name
phnH
UniProt Synonym Gene Names
RPnTP synthase subunit PhnH
NCBI Description
Phosphonate utilization is cryptic in K-12. [More information is available at EcoGene: EG10717]. PhnH appears to be a component of a carbon-phosphorous lyase enzyme. phnHis part of an operon that is phosphate starvation-inducible and required for use of phosphonate and phosphite as phosphorous sources . [More information is available at EcoCyc: EG10717].
Uniprot Description
Together with PhnG, PhnI and PhnL is required for the transfer of the ribose triphosphate moiety from ATP to methyl phosphonate.
Research Articles on phnH
Similar Products
Product Notes
The phnH phnh (Catalog #AAA1212916) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-194, full length protein. The amino acid sequence is listed below: MTLETAFMLP VQDAQHSFRR LLKAMSEPGV IVALHQLKRG WQPLNIATTS VLLTLADNDT PVWLSTPLNN DIVNQSLRFH TNAPLVSQPE QATFAVTDEA ISSEQLNALS TGTAVAPEAG ATLILQVASL SGGRMLRLTG AGIAEERMIA PQLPECILHE LTERPHPFPL GIDLILTCGE RLLAIPRTTH VEVC. It is sometimes possible for the material contained within the vial of "Protein phnH (phnH), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
