Cytochrome c oxidase subunit 2 (ctaC) Recombinant Protein | ctaC recombinant protein
Recombinant Cytochrome c oxidase subunit 2 (ctaC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c oxidase subunit 2 (ctaC); Recombinant Cytochrome c oxidase subunit 2 (ctaC); Cytochrome c oxidase subunit 2 EC= 1.9.3.1; Cytochrome aa3 subunit 2 Cytochrome c oxidase polypeptide II Oxidase aa(3) subunit 2; ctaC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-280
Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFA
Sequence Length
298
Species
Paracoccus denitrificans
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
32,539 Da
NCBI Official Full Name
Cytochrome c oxidase subunit 2
UniProt Protein Name
Cytochrome c oxidase subunit 2
Protein Family
UniProt Gene Name
ctaC
UniProt Synonym Gene Names
coiI; ctaB
UniProt Entry Name
COX2_PARDE
Uniprot Description
Function: Subunits I and II form the functional core of the enzyme complex. Electrons originating in cytochrome c are transferred via heme a and Cu(A) to the binuclear center formed by heme a3 and Cu(B).
Catalytic activity: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
Cofactor: Binds 2 copper A ions per subunit.
Subcellular location: Cell inner membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the cytochrome c oxidase subunit 2 family.
Similar Products
Product Notes
The Cytochrome c oxidase subunit 2 (ctaC) ctac (Catalog #AAA1211735) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-280. The amino acid sequence is listed below: QDVLGDLPVI GKPVNGGMNF QPASSPLAHD QQWLDHFVLY IITAVTIFVC LLLLICIVRF NRRANPVPAR FTHNTPIEVI WTLVPVLILV AIGAFSLPIL FRSQEMPNDP DLVIKAIGHQ WYWSYEYPND GVAFDALMLE KEALADAGYS EDEYLLATDN PVVVPVGKKV LVQVTATDVI HAWTIPAFAV KQDAVPGRIA QLWFSVDQEG VYFGQCSELC GINHAYMPIV VKAVSQEKYE AWLAGAKEEF A. It is sometimes possible for the material contained within the vial of "Cytochrome c oxidase subunit 2 (ctaC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
