Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Deubiquitinase and deneddylase Dub2 (cdu2) Recombinant Protein | CTL0246 recombinant protein

Recombinant Chlamydia trachomatis serovar L2 Deubiquitinase and deneddylase Dub2 (cdu2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Deubiquitinase and deneddylase Dub2 (cdu2); Recombinant Chlamydia trachomatis serovar L2 Deubiquitinase and deneddylase Dub2 (cdu2); Recombinant Deubiquitinase and deneddylase Dub2 (cdu2); Deubiquitinase and deneddylase Dub2; ChlaDub2 EC= 3.4.22.-; CTL0246 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-339
Sequence
MEPIHNPPPQTCSYSRPSTTYTSFKDASCDTKVTRIIIALFLIVISCGLILCAYTFRDLLDADYLAQEGPQQATKLLQQLDDVLTGPPLPIWDNEHLFQFSCLMQNKHRRVLPIDICNPLTKFNFLECICNCLMTKQSVNVNETDMCELFCPPTCTPENYRRLLCTSSVFPFVMWHDPSADTQEAMLTKMDQTMSSGRVGNSHWVLVIVDIEYRCVTFFDSLCDYVASPQQMREQLEGLAVSLGAIYPKEGGADSDQEELLSPFQVRIGSTVKVQSPGEFTCGAWCCQFLAWYLENPDFDLEEKVPTNPSERRALLADFISTTEQAMSRYSSLSWPTTD
Sequence Length
339
Species
Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,368 Da
NCBI Official Full Name
hypothetical protein CTL0246
NCBI Official Symbol
CTL0246
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Deubiquitinase and deneddylase Dub2
UniProt Gene Name
cdu2
UniProt Synonym Gene Names
ChlaDub2
UniProt Entry Name
CDUB2_CHLT2

Uniprot Description

Function: Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. This protease possesses deubiquitinating and deneddylating activities

By similarity.

Subcellular location: Secreted

By similarity. Host cell

By similarity. Membrane; Single-pass membrane protein

By similarity. Note: Secreted, and delivered into the host cell

By similarity.

Sequence similarities: Belongs to the peptidase C48 family.

Similar Products

Product Notes

The CTL0246 cdu2 (Catalog #AAA1208182) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-339. The amino acid sequence is listed below: MEPIHNPPPQ TCSYSRPSTT YTSFKDASCD TKVTRIIIAL FLIVISCGLI LCAYTFRDLL DADYLAQEGP QQATKLLQQL DDVLTGPPLP IWDNEHLFQF SCLMQNKHRR VLPIDICNPL TKFNFLECIC NCLMTKQSVN VNETDMCELF CPPTCTPENY RRLLCTSSVF PFVMWHDPSA DTQEAMLTKM DQTMSSGRVG NSHWVLVIVD IEYRCVTFFD SLCDYVASPQ QMREQLEGLA VSLGAIYPKE GGADSDQEEL LSPFQVRIGS TVKVQSPGEF TCGAWCCQFL AWYLENPDFD LEEKVPTNPS ERRALLADFI STTEQAMSRY SSLSWPTTD. It is sometimes possible for the material contained within the vial of "Deubiquitinase and deneddylase Dub2 (cdu2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.