Fe-S cluster assembly protein DRE2 (DRE2) Recombinant Protein | DRE2 recombinant protein
Recombinant Coccidioides posadasii Fe-S cluster assembly protein DRE2 (DRE2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fe-S cluster assembly protein DRE2 (DRE2); Recombinant Coccidioides posadasii Fe-S cluster assembly protein DRE2 (DRE2); DRE2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-321, Full length protein
Sequence
MERMLLLSPPSLAARPERLNTILSSHSRYATDLQMLDRVAAGLVSLPQSTYDIVMLLTDVDGLGTGSTSAMGRGVIQSVVRALRPGGKFKRENGTFPSTECPDNTELMLAGLVFDDTGGLLKPDFGPENIVPLKLGKRKPVHSVSSNGTGTSGPHVNMQLSTGSMLKGQTTTIKGVGFVDFTDDPSLSEADIYSGQTDDELIDEETLLDGEDMGRPIIQPPECRPKAGKRRRACKDCTCGLAERLREEDKAARAKADATLETMKLAPKELAEVDFTVQGKLGSCGNCALGDAFRCDGCPYIGLPPFKPGEEVRLLSNDVQL
Sequence Length
321
Species
Coccidioides posadasii (strain C735) (Valley fever fungus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,444 Da
NCBI Official Full Name
hypothetical protein CPC735_035400
NCBI Official Symbol
CPC735_035400
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Fe-S cluster assembly protein DRE2
Protein Family
UniProt Gene Name
DRE2
Uniprot Description
Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the scaffold complex CFD1-NBP35. Electrons are transferred to DRE2 from NADPH via the FAD- and FMN-containing protein TAH18. TAH18-DRE2 are also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit RNR2.
Similar Products
Product Notes
The DRE2 dre2 (Catalog #AAA1207506) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-321, Full length protein. The amino acid sequence is listed below: MERMLLLSPP SLAARPERLN TILSSHSRYA TDLQMLDRVA AGLVSLPQST YDIVMLLTDV DGLGTGSTSA MGRGVIQSVV RALRPGGKFK RENGTFPSTE CPDNTELMLA GLVFDDTGGL LKPDFGPENI VPLKLGKRKP VHSVSSNGTG TSGPHVNMQL STGSMLKGQT TTIKGVGFVD FTDDPSLSEA DIYSGQTDDE LIDEETLLDG EDMGRPIIQP PECRPKAGKR RRACKDCTCG LAERLREEDK AARAKADATL ETMKLAPKEL AEVDFTVQGK LGSCGNCALG DAFRCDGCPY IGLPPFKPGE EVRLLSNDVQ L. It is sometimes possible for the material contained within the vial of "Fe-S cluster assembly protein DRE2 (DRE2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
