Probable aquaporin AqpM (aqpM) Recombinant Protein | glpF recombinant protein
Recombinant Archaeoglobus fulgidus Probable aquaporin AqpM (aqpM)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable aquaporin AqpM (aqpM); Recombinant Archaeoglobus fulgidus Probable aquaporin AqpM (aqpM); Recombinant Probable aquaporin AqpM (aqpM); Probable aquaporin AqpM; glpF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-246
Sequence
MTMTLAKRFTAEVVGTFILVFFGPGAAVITLMIANGADKPNEFNIGIGALGGLGDWFAIGMAFALAIAAVIYSLGRISGAHINPAVTIALWSIGRFPGREVVPYIVAQFIGAALGSLLFLACVGPAAATVGGLGATAPFPGIGYGQAILTEAIGTFLLMLVIMGVAVDERAPPGFAGLVIGLTVGGIITTIGNITGSSLNPARTFGPYLGDSLMGINLWQYFPIYVIGPIVGAVAAAWLYNYLAKE
Sequence Length
246
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,212 Da
NCBI Official Full Name
glycerol uptake facilitator, MIP channel (glpF)
NCBI Official Symbol
glpF
NCBI Protein Information
glycerol uptake facilitator, MIP channel (glpF)
UniProt Protein Name
Probable aquaporin AqpM
Protein Family
UniProt Gene Name
aqpM
UniProt Entry Name
AQPM_ARCFU
Uniprot Description
Function: Channel that permits osmotically driven movement of water in both directions
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein
By similarity.
Domain: Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
Sequence similarities: Belongs to the MIP/aquaporin (TC 1.A.8) family. [View classification]
Similar Products
Product Notes
The glpF aqpm (Catalog #AAA1205949) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-246. The amino acid sequence is listed below: MTMTLAKRFT AEVVGTFILV FFGPGAAVIT LMIANGADKP NEFNIGIGAL GGLGDWFAIG MAFALAIAAV IYSLGRISGA HINPAVTIAL WSIGRFPGRE VVPYIVAQFI GAALGSLLFL ACVGPAAATV GGLGATAPFP GIGYGQAILT EAIGTFLLML VIMGVAVDER APPGFAGLVI GLTVGGIITT IGNITGSSLN PARTFGPYLG DSLMGINLWQ YFPIYVIGPI VGAVAAAWLY NYLAKE. It is sometimes possible for the material contained within the vial of "Probable aquaporin AqpM (aqpM), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
