Beclin 1-associated autophagy-related key regulator (Atg14) Recombinant Protein | Atg14 recombinant protein
Recombinant Rat Beclin 1-associated autophagy-related key regulator (Atg14)
Gene Names
Atg14; Atg14L; RGD1304610
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beclin 1-associated autophagy-related key regulator (Atg14); Recombinant Rat Beclin 1-associated autophagy-related key regulator (Atg14); Atg14 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-492, full length protein
Sequence
MASPSGKGSWTPEAPGFGPRALAPDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSQLKNKQEEFQKEVLKAMEGKRLTDQLRWKIMSCKMRIEQLKQTICKGNEEMKKNSEGLLKNKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTSDLREHYDRLACLRRLHILELTSVIFPMDEVKTSGRDPADVSSETDSAMTSSMVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYNWVEEKKTTQGPDMEHNNPAYTISAALGYATQLVNIVSHILDINLPKKLCNSEFCGENLSKQRLTRAVRKLNANILYLCSSQHVNLDQLQPLHTLRNLMHLVSPHSEHLGRSGPFEVRADLEESMEFVDPGVAGESDVSGDERVSDEETDLGTDWENLPSPRFCDIPSQPVEVSQSQSTQASPPIASSSAGGMISSAAASVTSWFKAYTGHR
Sequence Length
492
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,345 Da
NCBI Official Full Name
beclin 1-associated autophagy-related key regulator
NCBI Official Synonym Full Names
autophagy related 14
NCBI Official Symbol
Atg14
NCBI Official Synonym Symbols
Atg14L; RGD1304610
NCBI Protein Information
beclin 1-associated autophagy-related key regulator
UniProt Protein Name
Beclin 1-associated autophagy-related key regulator
Protein Family
UniProt Gene Name
Atg14
UniProt Synonym Gene Names
Atg14L
Uniprot Description
Required for both basal and inducible autophagy. Determines the localization of the autophagy-specific PI3-kinase complex. Plays a role in autophagosome formation and MAP1LC3/LC3 conjugation to phosphatidylethanolamine. Promotes BECN1 translocation from the trans-Golgi network to autophagosomes. Enhances PIK3C3 activity in a BECN1-dependent manner. Essential for the autophagy-dependent phosphorylation of BECN1. Stimulates the phosphorylation of BECN1, but suppresses the phosphorylation PIK3C3 by AMPK. Binds to STX17-SNAP29 binary t-SNARE complex on autophagosomes and primes it for VAMP8 interaction to promote autophagosome-endolysosome fusion. Modulates the hepatic lipid metabolism ().
Similar Products
Product Notes
The Atg14 atg14 (Catalog #AAA1197651) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-492, full length protein. The amino acid sequence is listed below: MASPSGKGSW TPEAPGFGPR ALAPDLVDSV DDAEGLYVAV ERCPLCNTTR RRLTCAKCVQ SGDFVYFDGR DRERFIDKKE RLSQLKNKQE EFQKEVLKAM EGKRLTDQLR WKIMSCKMRI EQLKQTICKG NEEMKKNSEG LLKNKEKNQK LYSRAQRHQE KKEKIQRHNR KLGDLVEKKT SDLREHYDRL ACLRRLHILE LTSVIFPMDE VKTSGRDPAD VSSETDSAMT SSMVSKLAEA RRTTYLSGRW VCDDHNGDTS ISITGPWISL PNNGDYSAYY NWVEEKKTTQ GPDMEHNNPA YTISAALGYA TQLVNIVSHI LDINLPKKLC NSEFCGENLS KQRLTRAVRK LNANILYLCS SQHVNLDQLQ PLHTLRNLMH LVSPHSEHLG RSGPFEVRAD LEESMEFVDP GVAGESDVSG DERVSDEETD LGTDWENLPS PRFCDIPSQP VEVSQSQSTQ ASPPIASSSA GGMISSAAAS VTSWFKAYTG HR. It is sometimes possible for the material contained within the vial of "Beclin 1-associated autophagy-related key regulator (Atg14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
