Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GPI-anchored wall transfer protein 1 (GWT1) Recombinant Protein | GWT1 recombinant protein

Recombinant Saccharomyces cerevisiae GPI-anchored wall transfer protein 1 (GWT1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GPI-anchored wall transfer protein 1 (GWT1); Recombinant Saccharomyces cerevisiae GPI-anchored wall transfer protein 1 (GWT1); Recombinant GPI-anchored wall transfer protein 1 (GWT1); GPI-anchored wall transfer protein 1 EC= 2.3.-.-; GWT1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
279-356, Partial.
Sequence
DDRTLNFLILADRNCFFSANREGIFSFLGYCSIFLWGQNTGFYLLGNKPTLNNLYKPSTQDVVAASKKSSTWDYWTSV
Sequence Length
356
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,466 Da
NCBI Official Full Name
Gwt1p
NCBI Official Symbol
GWT1
NCBI Protein Information
Gwt1p
UniProt Protein Name
GPI-anchored wall transfer protein 1
UniProt Gene Name
GWT1
UniProt Entry Name
GWT1_YEAST

Uniprot Description

Function: Probable acetyltransferase, which acetylates the inositol ring of phosphatidylinositol during biosynthesis of GPI-anchor. Acetylation during GPI-anchor biosynthesis is not essential for the subsequent mannosylation and is usually removed soon after the attachment of GPIs to proteins. Ref.4 Ref.5

Pathway: Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.4 Ref.6.

Miscellaneous: Target of the antifungal compound 1-[4-butylbenzyl]isoquinoline that inhibits cell wall localization of GPI-anchored mannoproteins.

Sequence similarities: Belongs to the PIGW family.

Sequence caution: The sequence CAA58476.1 differs from that shown. Reason: Erroneous initiation. The sequence CAA89384.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on GWT1

Similar Products

Product Notes

The GWT1 gwt1 (Catalog #AAA1195974) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 279-356, Partial. The amino acid sequence is listed below: DDRTLNFLIL ADRNCFFSAN REGIFSFLGY CSIFLWGQNT GFYLLGNKPT LNNLYKPSTQ DVVAASKKSS TWDYWTSV . It is sometimes possible for the material contained within the vial of "GPI-anchored wall transfer protein 1 (GWT1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.