Opsin Rh4 (Rh4) Recombinant Protein | DpseRh4 recombinant protein
Recombinant Drosophila pseudoobscura pseudoobscura Opsin Rh4 (Rh4)
Gene Names
DpseRh4; DPSERH4; DpseGA28288; dpse_GLEANR_7870; GA28288; rh4; Rh4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Opsin Rh4 (Rh4); Recombinant Drosophila pseudoobscura pseudoobscura Opsin Rh4 (Rh4); Recombinant Opsin Rh4 (Rh4); Opsin Rh4; Inner R7 photoreceptor cells opsin; DpseRh4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-380
Sequence
MDALCNASEPPLRPEARMSSGSDELQFLGWNVPPDQIQYIPEHWLTQLEPPASMHYMLGVFYIFLFFASTLGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCLKAPIFIYNSFHRGFALGNTWCQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMNRNMTFTKAVIMNIIIWLYCTPWVVLPLTQFWDRFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCPTLMILYYYSQIVGHVFNHEKALREQAKKMNVESLRSNVDKSKETAEIRIAKAAITICFLFFVSWTPYGVMSLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRMELQKRCPWLGVNEKSGEASSAQSTTTQEQTQQTSAA
Sequence Length
380
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,942 Da
NCBI Official Full Name
Rh4
NCBI Official Symbol
DpseRh4
NCBI Official Synonym Symbols
DPSERH4; DpseGA28288; dpse_GLEANR_7870; GA28288; rh4; Rh4
NCBI Protein Information
GA28288 gene product from transcript GA28288-RA; DpseGA28288-PA; DpseRh4-PA; rhodopsin 4
UniProt Protein Name
Opsin Rh4
UniProt Gene Name
Rh4
UniProt Entry Name
OPS4_DROPS
Uniprot Description
Function: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Subcellular location: Membrane; Multi-pass membrane protein.
Post-translational modification: Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region.
Miscellaneous: Each Drosophila eye is composed of 800 facets or ommatidia. Each ommatidium contains 8 photoreceptor cells (R1-R8), the R1 to R6 cells are outer cells, while R7 and R8 are inner cells.Opsin Rh4 is sensitive to UV light.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.
Similar Products
Product Notes
The DpseRh4 rh4 (Catalog #AAA1190512) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-380. The amino acid sequence is listed below: MDALCNASEP PLRPEARMSS GSDELQFLGW NVPPDQIQYI PEHWLTQLEP PASMHYMLGV FYIFLFFAST LGNGMVIWIF STSKSLRTPS NMFVLNLAVF DLIMCLKAPI FIYNSFHRGF ALGNTWCQIF ASIGSYSGIG AGMTNAAIGY DRYNVITKPM NRNMTFTKAV IMNIIIWLYC TPWVVLPLTQ FWDRFVPEGY LTSCSFDYLS DNFDTRLFVG TIFFFSFVCP TLMILYYYSQ IVGHVFNHEK ALREQAKKMN VESLRSNVDK SKETAEIRIA KAAITICFLF FVSWTPYGVM SLIGAFGDKS LLTPGATMIP ACTCKLVACI DPFVYAISHP RYRMELQKRC PWLGVNEKSG EASSAQSTTT QEQTQQTSAA. It is sometimes possible for the material contained within the vial of "Opsin Rh4 (Rh4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
