Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Monopolar spindle protein 2 (MPS2) Recombinant Protein | MPS2 recombinant protein

Recombinant Saccharomyces cerevisiae Monopolar spindle protein 2 (MPS2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Monopolar spindle protein 2 (MPS2); Recombinant Saccharomyces cerevisiae Monopolar spindle protein 2 (MPS2); MPS2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-387
Sequence
MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSEINKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLNSPSKFLVENKNKNTEGAGISTPRKKLTESPIKLLSRXNIGKALEVQVEELKRELTAKQSLLQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQKAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISAVPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWFFEDQTDLETEYRSNANVDDAYSRVFGI
Sequence Length
387
Species
Saccharomyces cerevisiae (strain FostersO) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for MPS2 recombinant protein
MPS2; MMC1; FOSTERSO_1678

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
44,583 Da
UniProt Protein Name
Monopolar spindle protein 2
Protein Family
UniProt Gene Name
MPS2
UniProt Synonym Gene Names
MMC1
UniProt Entry Name
MPS2_YEASO

Uniprot Description

Function: Component of the spindle pole body (SPB) required for insertion of the nascent SPB into the nuclear envelope and for the proper execution of spindle pole body (SPB) duplication

By similarity.

Subunit structure: Interacts with BBP1, MPS3, and SPC24

By similarity.

Subcellular location: Nucleus membrane; Single-pass membrane protein

By similarity. Cytoplasm › cytoskeleton › spindle pole body

By similarity.

Sequence similarities: Belongs to the MPS2 family.

Similar Products

Product Notes

The Monopolar spindle protein 2 (MPS2) mps2 (Catalog #AAA1182837) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-387. The amino acid sequence is listed below: MSNGAFDAIF EYAWGQIDKP ISGDFIYGKD LPKLIEIIEN IFQKAQKSGS YELRLPLFSE INKDLFRTFS NTKTFFKIHK EEFDDIFFNL VNHPLREILE NAFIGVDSIP SDFIVSMNLN SPSKFLVENK NKNTEGAGIS TPRKKLTESP IKLLSRXNIG KALEVQVEEL KRELTAKQSL LQENERQVSE LKIRLETYQE KYASIQQRFS DLQKARQVED NQNSSRTSDP GSPLVTGIDQ KAILEEFRRR LQRQTDTISF LKDQIRRERG LNCSNDKVSH SKRKHATTDG DGTFKNFISA VPSNIWVKAT IRIIVCFALL AGVLPYIRKY VYAHDTPSQN SRLQLSWWEN SGILSKIVWF FEDQTDLETE YRSNANVDDA YSRVFGI. It is sometimes possible for the material contained within the vial of "Monopolar spindle protein 2 (MPS2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.