Enhancer of yellow 2 transcription factor (e (y)2) Recombinant Protein | e(y)2 recombinant protein

Recombinant Drosophila yakuba Enhancer of yellow 2 transcription factor (e (y)2)

Cat. Num. AAA1181398

• Gene Names: DyakGE17290; dyak_GLEANR_18633; GE17290
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Enhancer of yellow 2 transcription factor (e (y)2); Recombinant Drosophila yakuba Enhancer of yellow 2 transcription factor (e (y)2); e(y)2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-101, full length protein
• Sequence: MSVSAAVDQYTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILLEKGTNNSFTVEQLITEVTPKARTLVPDAVKKELLMKIRTILTENEEEADEAEEEP
• Sequence Length: 101

• Species: Drosophila yakuba (Fruit fly)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 195479328
• NCBI GeneID: 6525008
• NCBI Accession #: XP_002100847.1
• NCBI GenBank Nucleotide #: XM_002100811.2
• UniProt Accession #: B4PY93
• Molecular Weight: 11,471 Da
• NCBI Official Full Name: uncharacterized protein Dyak_GE17290
• NCBI Official Symbol: DyakGE17290
• NCBI Official Synonym Symbols: dyak_GLEANR_18633; GE17290
• NCBI Protein Information: GE17290 gene product from transcript GE17290-RA
• UniProt Protein Name: Enhancer of yellow 2 transcription factor
• Protein Family: Enhancer of yellow 2 transcription factor
• UniProt Gene Name: e(y)2

Uniprot Description

Involved in mRNA export coupled transcription activation by association with both the AMEX and the SAGA complexes. The SAGA complex is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Involved in transcription elongation by recruiting the THO complex onto nascent mRNA. The AMEX complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). AMEX participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery ().