Phosphoglycerol transferase I (mdoB) Recombinant Protein | CKO_03440 recombinant protein
Recombinant Citrobacter koseri Phosphoglycerol transferase I (mdoB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphoglycerol transferase I (mdoB); Recombinant Citrobacter koseri Phosphoglycerol transferase I (mdoB); Recombinant Phosphoglycerol transferase I (mdoB); Phosphoglycerol transferase I EC= 2.7.8.20; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase; CKO_03440 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-763
Sequence
MSELLSIALFLASVLIYAWKAGRNTWWFAAILAVLGLFVVLNITLYASDYFTGDGINDAVLYTLTNSLTGAGVSKYILPGAGIVLALAAVFSALGWVLRRRRHHPHHFGYSLLALLLALGSVDASPAFRQISELVKSQSRDGDPDFPAYYKEPSKTIPNPQLNLVYIYGESLERTYFDNDAFPDLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFFPQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKTVVADPSYRNDWGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDFDGKPNQSFSAVSCSQENIAEFINKIKASPWFKNTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVLRGDQPQQDTLAVKRNTMDNGATVLDILGGDNFIGLGRSSLSGQSLSEVFLNSKEKILAMKPDIIRLWNFPKEMKDFTVDRDKDMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLANFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQSIQHVDKAQWKGKTAFKDTVIDMERYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQLGDEVKIEYNTPLPKKFDLVITAKAFGANANRPIPVRVGKEEQTLVLENEVTTTTLHFDNPSNASTLVIVPPDPVSTNEGNILGHSPRKLGIGMVEIKVVNAEG
Sequence Length
763
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85,151 Da
NCBI Official Full Name
phosphoglycerol transferase I
NCBI Official Symbol
CKO_03440
NCBI Protein Information
phosphoglycerol transferase I
UniProt Protein Name
Phosphoglycerol transferase I
UniProt Gene Name
mdoB
UniProt Synonym Gene Names
opgB
UniProt Entry Name
OPGB_CITK8
Uniprot Description
Function: Transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones
By similarity. HAMAP-Rule MF_01070
Catalytic activity: Phosphatidylglycerol + membrane-derived-oligosaccharide D-glucose = 1,2-diacyl-sn-glycerol + membrane-derived-oligosaccharide 6-(glycerophospho)-D-glucose. HAMAP-Rule MF_01070
Pathway: Glycan metabolism; osmoregulated periplasmic glucan (OPG) biosynthesis. HAMAP-Rule MF_01070
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01070.
Sequence similarities: Belongs to the OpgB family.
Similar Products
Product Notes
The CKO_03440 mdob (Catalog #AAA1180739) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-763. The amino acid sequence is listed below: MSELLSIALF LASVLIYAWK AGRNTWWFAA ILAVLGLFVV LNITLYASDY FTGDGINDAV LYTLTNSLTG AGVSKYILPG AGIVLALAAV FSALGWVLRR RRHHPHHFGY SLLALLLALG SVDASPAFRQ ISELVKSQSR DGDPDFPAYY KEPSKTIPNP QLNLVYIYGE SLERTYFDND AFPDLTPELG ALKNEGLDFS HTMQLPGTDY TIAGMVASQC GIPLFAPFEG NASASVSSFF PQNICLGDIL KNSGYQNYFV QGANLRFAGK DVFLKSHGFD HLYGAEELKT VVADPSYRND WGFYDDTVLD EAWKKFEELS RSGQRFSLFT LTVDTHHPDG FISRTCNRKR YDFDGKPNQS FSAVSCSQEN IAEFINKIKA SPWFKNTVIV VSSDHLAMNN TAWKYLNKQD RNNLFFVLRG DQPQQDTLAV KRNTMDNGAT VLDILGGDNF IGLGRSSLSG QSLSEVFLNS KEKILAMKPD IIRLWNFPKE MKDFTVDRDK DMIAFSGSHF RLPLLLRVSD KRVEPLPESE YSAPLRFQLA NFAPRDNFVW VDRCYKMAQL WAPELALSTD WCVSQGQLGG QQSIQHVDKA QWKGKTAFKD TVIDMERYKG NVDTLKIVDN DIRYKADSFI FNVAGAPEEV KQFSGISRPE SWGRWSNAQL GDEVKIEYNT PLPKKFDLVI TAKAFGANAN RPIPVRVGKE EQTLVLENEV TTTTLHFDNP SNASTLVIVP PDPVSTNEGN ILGHSPRKLG IGMVEIKVVN AEG. It is sometimes possible for the material contained within the vial of "Phosphoglycerol transferase I (mdoB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
