SDS-PAGE
Protein-lysine 6-oxidase Recombinant Protein | Lox recombinant protein
Recombinant Rat Protein-lysine 6-oxidase
Gene Names
Lox; Rrg1; H-rev142
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein-lysine 6-oxidase; Recombinant Rat Protein-lysine 6-oxidase; Lysyl oxidase; Lox recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
163-411aa; Full Length
Sequence
DDPYNPYKYSDDNPYYNYYDTYERPRSGSRHRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASGCTISPY
Sequence Length
411
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Lox recombinant protein
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin.
References
Cloning of rat aorta lysyl oxidase cDNA
complete codons and predicted amino acid sequence.Trackman P.C., Pratt A.M., Wolanski A., Tang S.-S., Offner G.D., Troxler R.F., Kagan H.M.Biochemistry 29:4863-4870(1990)
Cloning of rat aorta lysyl oxidase cDNA
complete codons and predicted amino acid sequence.Trackman P.C., Pratt A.M., Wolanski A., Tang S.-S., Offner G.D., Troxler R.F., Kagan H.M.Biochemistry 30:8282-8282(1991)
Metalloproteinase activity secreted by fibrogenic cells in the processing of prolysyl oxidase. Potential role of procollagen C-proteinase.Panchenko M.V., Stetler-Stevenson W.G., Trubetskoy O.V., Gacheru S.N., Kagan H.M.J. Biol. Chem. 271:7113-7119(1996)
Post-translational glycosylation and proteolytic processing of a lysyl oxidase precursor.Trackman P.C., Bedell-Hogan D., Tang J., Kagan H.M.J. Biol. Chem. 267:8666-8671(1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
protein-lysine 6-oxidase
NCBI Official Synonym Full Names
lysyl oxidase
NCBI Official Symbol
Lox
NCBI Official Synonym Symbols
Rrg1; H-rev142
NCBI Protein Information
protein-lysine 6-oxidase
UniProt Protein Name
Protein-lysine 6-oxidase
Protein Family
UniProt Gene Name
Lox
UniProt Entry Name
LYOX_RAT
NCBI Description
enzyme involved in the catalysis of the reaction required for cross-linking of collagen and elastin fibers [RGD, Feb 2006]
Uniprot Description
LOX: Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. In addition to cross-linking of extracellular matrix proteins, may have a direct role in tumor suppression. Belongs to the lysyl oxidase family.
Protein type: Secreted, signal peptide; EC 1.4.3.13; Oxidoreductase; Secreted
Cellular Component: collagen; extracellular space; nucleus; proteinaceous extracellular matrix
Molecular Function: copper ion binding; protein-lysine 6-oxidase activity
Biological Process: blood vessel development; collagen fibril organization; elastic fiber assembly; heart development; lung development; response to drug; response to hormone stimulus; response to steroid hormone stimulus; wound healing
Research Articles on Lox
Similar Products
Product Notes
The Lox lox (Catalog #AAA1179639) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 163-411aa; Full Length. The amino acid sequence is listed below: DDPYNPYKYS DDNPYYNYYD TYERPRSGSR HRPGYGTGYF QYGLPDLVPD PYYIQASTYV QKMSMYNLRC AAEENCLASS AYRADVRDYD HRVLLRFPQR VKNQGTSDFL PSRPRYSWEW HSCHQHYHSM DEFSHYDLLD ASTQRRVAEG HKASFCLEDT SCDYGYHRRF ACTAHTQGLS PGCYDTYAAD IDCQWIDITD VQPGNYILKV SVNPSYLVPE SDYSNNVVRC EIRYTGHHAY ASGCTISPY. It is sometimes possible for the material contained within the vial of "Protein-lysine 6-oxidase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
