Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Glycerol-3-phosphate acyltransferase (plsY) Recombinant Protein | PC1_3411 recombinant protein

Recombinant Pectobacterium carotovorum subsp. carotovorum Glycerol-3-phosphate acyltransferase (plsY)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycerol-3-phosphate acyltransferase (plsY); Recombinant Pectobacterium carotovorum subsp. carotovorum Glycerol-3-phosphate acyltransferase (plsY); Recombinant Glycerol-3-phosphate acyltransferase (plsY); Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase; GPAT EC= 2.3.1.n3 Lysophosphatidic acid synthase; LPA syn; PC1_3411 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-211
Sequence
MSVTALGMMLIAYLCGSISSAILFCRIAGLPDPRQHGSGNPGATNVLRIGGKAAAATVLVFDVLKGMLPVWAAYALGVSPLYLGLTAIAACLGHIYPVFFHFRGGKGVATAFGAIAPIGWDLTGLMTGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVAMLSCLILMRHHDNIQRLWRGQESKIWNKLRKKKQPEDEKTSPEE
Sequence Length
211
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,866 Da
NCBI Official Full Name
hypothetical protein PC1_3411
NCBI Official Symbol
PC1_3411
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Glycerol-3-phosphate acyltransferase
UniProt Gene Name
plsY
UniProt Synonym Gene Names
GPAT
UniProt Entry Name
PLSY_PECCP

Uniprot Description

Function: Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as fatty acyl donor, but not acyl-CoA or acyl-ACP

By similarity. HAMAP-Rule MF_01043

Catalytic activity: Acyl-phosphate + sn-glycerol 3-phosphate = 1-acyl-sn-glycerol 3-phosphate + phosphate. HAMAP-Rule MF_01043

Pathway: Lipid metabolism; phospholipid metabolism. HAMAP-Rule MF_01043

Subunit structure: Probably interacts with PlsX

By similarity. HAMAP-Rule MF_01043

Subcellular location: Cell inner membrane; Multi-pass membrane protein

By similarity HAMAP-Rule MF_01043.

Sequence similarities: Belongs to the PlsY family.

Similar Products

Product Notes

The PC1_3411 plsy (Catalog #AAA1179614) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-211. The amino acid sequence is listed below: MSVTALGMML IAYLCGSISS AILFCRIAGL PDPRQHGSGN PGATNVLRIG GKAAAATVLV FDVLKGMLPV WAAYALGVSP LYLGLTAIAA CLGHIYPVFF HFRGGKGVAT AFGAIAPIGW DLTGLMTGTW LLTVLLSGYS SLGAIVSALI APFYVWWFKP QFTFPVAMLS CLILMRHHDN IQRLWRGQES KIWNKLRKKK QPEDEKTSPE E. It is sometimes possible for the material contained within the vial of "Glycerol-3-phosphate acyltransferase (plsY), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual