Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein PHLOEM PROTEIN 2-LIKE A2 (PP2A2) Recombinant Protein | AT4G19850 recombinant protein

Recombinant Arabidopsis thaliana Protein PHLOEM PROTEIN 2-LIKE A2 (PP2A2)

Gene Names
AT4G19850; ARABIDOPSIS THALIANA PHLOEM PROTEIN 2-A2; ATPP2-A2; phloem protein 2-A2; PP2-A2; PP2A2; T16H5.210; T16H5_210
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein PHLOEM PROTEIN 2-LIKE A2 (PP2A2); Recombinant Arabidopsis thaliana Protein PHLOEM PROTEIN 2-LIKE A2 (PP2A2); AT4G19850 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-194
Sequence
MRVKRRKTVSCCTREISQLHGQSLKQINIGVGSLILTKHQGYEFYCKKVTFVFFCFFKISLNSAYLYTLYSDVRTEVAKMERVAWLEVVGKFETEKLTPNSLYEVVFVVKLIDSAKGWDFRVNFKLVLPTGETKERRENVNLLERNKWVEIPAGEFMISPEHLSGKIEFSMLEVKSDQWKSGLIVKGVAIRPKN
Sequence Length
194
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for AT4G19850 recombinant protein
PP2A2

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,480 Da
NCBI Official Full Name
protein PHLOEM protein 2-LIKE A2
NCBI Official Symbol
AT4G19850
NCBI Official Synonym Symbols
ARABIDOPSIS THALIANA PHLOEM PROTEIN 2-A2; ATPP2-A2; phloem protein 2-A2; PP2-A2; PP2A2; T16H5.210; T16H5_210
NCBI Protein Information
protein PHLOEM protein 2-LIKE A2
UniProt Protein Name
Protein PHLOEM PROTEIN 2-LIKE A2
UniProt Gene Name
PP2A2
UniProt Synonym Gene Names
AtPP2-A2
UniProt Entry Name
P2A02_ARATH

NCBI Description

encodes a protein similar to phloem protein 2 in cucumber. a member of a large gene family.

Uniprot Description

Subcellular location: Membrane; Single-pass membrane protein

Potential.

Tissue specificity: Vascular tissues, specifically in phloem companion cell-sieve element complexes. Ref.4

Similar Products

Product Notes

The AT4G19850 pp2a2 (Catalog #AAA1179577) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-194. The amino acid sequence is listed below: MRVKRRKTVS CCTREISQLH GQSLKQINIG VGSLILTKHQ GYEFYCKKVT FVFFCFFKIS LNSAYLYTLY SDVRTEVAKM ERVAWLEVVG KFETEKLTPN SLYEVVFVVK LIDSAKGWDF RVNFKLVLPT GETKERRENV NLLERNKWVE IPAGEFMISP EHLSGKIEFS MLEVKSDQWK SGLIVKGVAI RPKN. It is sometimes possible for the material contained within the vial of "Protein PHLOEM PROTEIN 2-LIKE A2 (PP2A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.