Kallikrein 1-related peptidase b9 (Klk1b9) Recombinant Protein | Klk1b9 recombinant protein
Recombinant Mouse Kallikrein 1-related peptidase b9 (Klk1b9)
Gene Names
Klk1b9; KAL; Klk9; mGk-9; Egfbp3; Egfbp-3; EGF-BP C; kallikrein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Kallikrein 1-related peptidase b9 (Klk1b9); Recombinant Mouse Kallikrein 1-related peptidase b9 (Klk1b9); Klk1b9 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-261, full length protein
Sequence
IVGGFKCEKNSQPWHVAVYRYNEYICGGVLLDANWVLTAAHCYYEENKVSLGKNNLYEEEPSAQHRLVSKSFLHPGYNRSLHRNHIRHPEYDYSNDLMLLRLSKPADITDVVKPIALPTEEPKLGSTCLASGWGSTTPFKFQNAKDLQCVNLKLLPNEDCGKAHIEKVTDVMLCAGETDGGKDTCKGDSGGPLICDGVLQGITSWGFTPCGEPKKPGVYTKLIKFTSWIKDTMAKNL
Sequence Length
237
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,900 Da
NCBI Official Full Name
kallikrein 1-related peptidase b9 preproprotein
NCBI Official Synonym Full Names
kallikrein 1-related peptidase b9
NCBI Official Symbol
Klk1b9
NCBI Official Synonym Symbols
KAL; Klk9; mGk-9; Egfbp3; Egfbp-3; EGF-BP C; kallikrein
NCBI Protein Information
kallikrein 1-related peptidase b9
UniProt Protein Name
Kallikrein 1-related peptidase b9
Protein Family
UniProt Gene Name
Klk1b9
UniProt Synonym Gene Names
Egfbp3; Klk-9; Klk9; EGF-BP C; mGK-9
NCBI Description
This gene encodes a member of the kallikrein subfamily of serine proteases that are involved in diverse physiological functions such as skin desquamation, tooth enamel formation, seminal liquefaction, synaptic neural plasticity and brain function. The encoded preproprotein undergoes proteolytic cleavage of the activation peptide to generate the functional enzyme. This gene is located in a cluster of several related kallikrein genes on chromosome 7. [provided by RefSeq, Feb 2016]
Uniprot Description
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Similar Products
Product Notes
The Klk1b9 klk1b9 (Catalog #AAA1175489) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-261, full length protein. The amino acid sequence is listed below: IVGGFKCEKN SQPWHVAVYR YNEYICGGVL LDANWVLTAA HCYYEENKVS LGKNNLYEEE PSAQHRLVSK SFLHPGYNRS LHRNHIRHPE YDYSNDLMLL RLSKPADITD VVKPIALPTE EPKLGSTCLA SGWGSTTPFK FQNAKDLQCV NLKLLPNEDC GKAHIEKVTD VMLCAGETDG GKDTCKGDSG GPLICDGVLQ GITSWGFTPC GEPKKPGVYT KLIKFTSWIK DTMAKNL. It is sometimes possible for the material contained within the vial of "Kallikrein 1-related peptidase b9 (Klk1b9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
