Formyl peptide receptor-related sequence 1 (Fpr-s1) Recombinant Protein | Fpr3 recombinant protein
Recombinant Mouse Formyl peptide receptor-related sequence 1 (Fpr-s1)
Gene Names
Fpr3; ALX; Fprl1; Lxa4r; Fpr-s1; LXA4-R; Fpr-rs1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Formyl peptide receptor-related sequence 1 (Fpr-s1); Recombinant Mouse Formyl peptide receptor-related sequence 1 (Fpr-s1); Recombinant Formyl peptide receptor-related sequence 1 (Fpr-s1); Formyl peptide receptor-related sequence 1; FMLP-related receptor I; FMLP-R-I Formyl peptide receptor related sequence 1 Formyl peptide receptor-like 1 Lipoxin A4 receptor; LXA4 receptor N-f; Fpr3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-351
Sequence
METNYSIPLNGSDVVIYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVTTIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIAVDVNLFGSVFLIAVIALDRCICVLHPVWAQNHRTVSLARNVVVGSWIFALILTLPLFLFLTTVRDARGDVHCRLSFVSWGNSVEERLNTAITFVTTRGIIRFIVSFSLPMSFVAICYGLITTKIHKKAFVNSSRPFRVLTGVVASFFICWFPFQLVALLGTVWLKEMQFSGSYKIIGRLVNPTSSLAFFNSCLNPILYVFMGQDFQERLIHSLSSRLQRALSEDSGHISDTRTNLASLPEDIEIKAI
Sequence Length
351
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,523 Da
NCBI Official Full Name
formyl peptide receptor-related sequence 1
NCBI Official Synonym Full Names
formyl peptide receptor 3
NCBI Official Symbol
Fpr3
NCBI Official Synonym Symbols
ALX; Fprl1; Lxa4r; Fpr-s1; LXA4-R; Fpr-rs1
NCBI Protein Information
formyl peptide receptor-related sequence 1; FMLP-R-I; LXA4 receptor; lipoxin A4 receptor; FMLP-related receptor I; N-formyl peptide receptor 2; N-formyl peptide receptor 3; formyl peptide receptor-like 1; N-formylpeptide receptor-like 1
UniProt Protein Name
Formyl peptide receptor-related sequence 1
Protein Family
UniProt Gene Name
Fpr-s1
UniProt Synonym Gene Names
Fpr2; Fpr3; Fprl1; Lxa4r; FMLP-R-I
UniProt Entry Name
FPRS1_MOUSE
Uniprot Description
Function: Low affinity receptor for N-formyl-methionyl peptides. Receptor for lipoxin A4. May have an olfactory function associated with the identification of pathogens or of pathogenic states. Ref.3
Subcellular location: Cell membrane; Multi-pass membrane protein.
Tissue specificity: Expressed exclusively in vomeronasal neurons (Ref.3 and Ref.4). Expressed in 0.6 % of a subset of sensory neurons located in the basal layer of the vomeronasal organ. Each neuron appears to express only one receptor gene. Expressed mostly in neutrophils, followed by spleen and lung and expressed at very low levels in heart and liver (Ref.3). Ref.1 Ref.2 Ref.3 Ref.4
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Research Articles on Fpr3
Similar Products
Product Notes
The Fpr3 fpr-s1 (Catalog #AAA1170764) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-351. The amino acid sequence is listed below: METNYSIPLN GSDVVIYDST ISRVLWILSM VVVSITFFLG VLGNGLVIWV AGFRMPHTVT TIWYLNLALA DFSFTATLPF LLVEMAMKEK WPFGWFLCKL VHIAVDVNLF GSVFLIAVIA LDRCICVLHP VWAQNHRTVS LARNVVVGSW IFALILTLPL FLFLTTVRDA RGDVHCRLSF VSWGNSVEER LNTAITFVTT RGIIRFIVSF SLPMSFVAIC YGLITTKIHK KAFVNSSRPF RVLTGVVASF FICWFPFQLV ALLGTVWLKE MQFSGSYKII GRLVNPTSSL AFFNSCLNPI LYVFMGQDFQ ERLIHSLSSR LQRALSEDSG HISDTRTNLA SLPEDIEIKA I. It is sometimes possible for the material contained within the vial of "Formyl peptide receptor-related sequence 1 (Fpr-s1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
