Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative osmoprotectant uptake system permease protein yehW (yehW) Recombinant Protein | yehW recombinant protein

Recombinant Escherichia coli Putative osmoprotectant uptake system permease protein yehW (yehW)

Gene Names
yehW; ECK2121; JW2116
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative osmoprotectant uptake system permease protein yehW (yehW); Recombinant Escherichia coli Putative osmoprotectant uptake system permease protein yehW (yehW); Recombinant Putative osmoprotectant uptake system permease protein yehW (yehW); Putative osmoprotectant uptake system permease protein yehW; yehW recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-243
Sequence
MKMLRDPLFWLIALFVALIFWLPYSQPLFAALFPQLPRPVYQQESFAALALAHFWLVGISSLFAVIIGTGAGIAVTRPWGAEFRPLVETIAAVGQTFPPVAVLAIAVPVIGFGLQPAIIALILYGVLPVLQATLAGLGAIDASVTEVAKGMGMSRGQRVRKVELPLAAPVILAGVRTSVIINIGTATIASTVGASTLGTPIIIGLSGFNTAYVIQGALLVALAAIIADRLFERLVQALSQHAK
Sequence Length
243
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,515 Da
NCBI Official Full Name
predicted transporter subunit: membrane component of ABC superfamily
NCBI Official Symbol
yehW
NCBI Official Synonym Symbols
ECK2121; JW2116
NCBI Protein Information
predicted transporter subunit: membrane component of ABC superfamily
UniProt Protein Name
Putative osmoprotectant uptake system permease protein YehW
UniProt Gene Name
yehW
UniProt Entry Name
YEHW_ECOLI

NCBI Description

RpoS regulon. [More information is available at EcoGene: EG12009]. YehW is a membrane component of an ABC transporter involved in osmoprotection. [More information is available at EcoCyc: EG12009].

Uniprot Description

Function: May be part of an ABC transporter complex involved in uptake of osmoprotectant molecules. Probably responsible for the translocation of the substrate across the membrane. Ref.4

Subunit structure: The complex is composed of two ATP-binding proteins (YehX), two transmembrane proteins (YehW and YehY) and a solute-binding protein (OsmF)

Probable.

Subcellular location: Cell inner membrane; Multi-pass membrane protein.

Induction: Expression is sigma S-dependent. Induced by both osmotic shock and entry into stationary phase. Ref.4

Sequence similarities: Belongs to the binding-protein-dependent transport system permease family. CysTW subfamily.Contains 1 ABC transmembrane type-1 domain.

Similar Products

Product Notes

The yehW yehw (Catalog #AAA1168685) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-243. The amino acid sequence is listed below: MKMLRDPLFW LIALFVALIF WLPYSQPLFA ALFPQLPRPV YQQESFAALA LAHFWLVGIS SLFAVIIGTG AGIAVTRPWG AEFRPLVETI AAVGQTFPPV AVLAIAVPVI GFGLQPAIIA LILYGVLPVL QATLAGLGAI DASVTEVAKG MGMSRGQRVR KVELPLAAPV ILAGVRTSVI INIGTATIAS TVGASTLGTP IIIGLSGFNT AYVIQGALLV ALAAIIADRL FERLVQALSQ HAK. It is sometimes possible for the material contained within the vial of "Putative osmoprotectant uptake system permease protein yehW (yehW), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.