Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Synaptotagmin-7 (SYT7) Recombinant Protein | SYT7 recombinant protein

Recombinant Human Synaptotagmin-7 (SYT7)

Gene Names
SYT7; IPCA7; IPCA-7; SYTVII; PCANAP7; SYT-VII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Synaptotagmin-7 (SYT7); Recombinant Human Synaptotagmin-7 (SYT7); Synaptotagmin-7; IPCA-7; Prostate cancer-associated protein 7; Synaptotagmin VII; SytVII; SYT7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
38-403. intact intracellular domain
Sequence
CHWCQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA
Sequence Length
403
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,821 Da
NCBI Official Full Name
synaptotagmin-7 isoform 1
NCBI Official Synonym Full Names
synaptotagmin VII
NCBI Official Symbol
SYT7
NCBI Official Synonym Symbols
IPCA7; IPCA-7; SYTVII; PCANAP7; SYT-VII
NCBI Protein Information
synaptotagmin-7; prostate cancer-associated protein 7
UniProt Protein Name
Synaptotagmin-7
Protein Family
UniProt Gene Name
SYT7
UniProt Synonym Gene Names
PCANAP7; SytVII
UniProt Entry Name
SYT7_HUMAN

NCBI Description

This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. A similar protein in rodents mediates hormone secretion and lysosome exocytosis. In humans, expression of this gene has been associated with prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

SYT7: May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Belongs to the synaptotagmin family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q12.2

Cellular Component: synaptic vesicle membrane; lysosome; integral to membrane; plasma membrane; cell junction

Molecular Function: calcium-dependent phospholipid binding; transporter activity; calcium ion binding

Biological Process: positive regulation of calcium ion-dependent exocytosis; exocytosis; plasma membrane repair; regulation of insulin secretion

Research Articles on SYT7

Similar Products

Product Notes

The SYT7 syt7 (Catalog #AAA1158149) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 38-403. intact intracellular domain. The amino acid sequence is listed below: CHWCQRKLGK RYKNSLETVG TPDSGRGRSE KKAIKLPAGG KAVNTAPVPG QTPHDESDRR TEPRSSVSDL VNSLTSEMLM LSPGSEEDEA HEGCSRENLG RIQFSVGYNF QESTLTVKIM KAQELPAKDF SGTSDPFVKI YLLPDKKHKL ETKVKRKNLN PHWNETFLFE GFPYEKVVQR ILYLQVLDYD RFSRNDPIGE VSIPLNKVDL TQMQTFWKDL KPCSDGSGSR GELLLSLCYN PSANSIIVNI IKARNLKAMD IGGTSDPYVK VWLMYKDKRV EKKKTVTMKR NLNPIFNESF AFDIPTEKLR ETTIIITVMD KDKLSRNDVI GKIYLSWKSG PGEVKHWKDM IARPRQPVAQ WHQLKA . It is sometimes possible for the material contained within the vial of "Synaptotagmin-7 (SYT7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.