Mucin-1 (Muc1) Recombinant Protein | Muc1 recombinant protein
Recombinant Mouse Mucin-1 (Muc1), partial
Gene Names
Muc1; EMA; CD227; Muc-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mucin-1 (Muc1); Recombinant Mouse Mucin-1 (Muc1); partial; Muc1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-535aa; Partial, provide the complete extracellular domain.
Sequence
FLALPSEENSVTSSQDTSSSLASTTTPVHSSNSDPATRPPGDSTSSPVQSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVNSASSPVAHGDTSSPATSLSKDSNSSPVVHSGTSSAATTAPVDSTSSPVVHGGTSSPATSPPGDSTSSPDHSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVDSTSSPVAHDDTSSPATSLSEDSASSPVAHGGTSSPATSPLRDSTSSPVHSSASIQNIKTTSDLASTPDHNGTSVTTTSSALGSATSPDHSGTSTTTNSSESVLATTPVYSSMPFSTTKVTSGSAIIPDHNGSSVLPTSSVLGSATSLVYNTSAIATTPVSNGTQPSVPSQYPVSPTMATTSSHSTIASSSYYSTVPFSTFSSNSSPQLSVGVSFFFLSFYIQNHPFNSSLEDPSSNYYQELKRNISGLFLQIFNGDFLGISSIKFRSGSVVVESTVVFREGTFSASDVKSQLIQHKKEADDYNLTISEVKVNEMQFPPSAQSRPGVPGWG
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Muc1 recombinant protein
This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,539 Da
NCBI Official Full Name
mucin-1
NCBI Official Synonym Full Names
mucin 1, transmembrane
NCBI Official Symbol
Muc1
NCBI Official Synonym Symbols
EMA; CD227; Muc-1
NCBI Protein Information
mucin-1
UniProt Protein Name
Mucin-1
Protein Family
UniProt Gene Name
Muc1
UniProt Synonym Gene Names
Muc-1; MUC-1; MUC1-NT; MUC1-alpha; MUC1-beta
Uniprot Description
The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.
Research Articles on Muc1
Similar Products
Product Notes
The Muc1 muc1 (Catalog #AAA1157634) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-535aa; Partial, provide the complete extracellular domain. The amino acid sequence is listed below: FLALPSEENS VTSSQDTSSS LASTTTPVHS SNSDPATRPP GDSTSSPVQS STSSPATRAP EDSTSTAVLS GTSSPATTAP VNSASSPVAH GDTSSPATSL SKDSNSSPVV HSGTSSAATT APVDSTSSPV VHGGTSSPAT SPPGDSTSSP DHSSTSSPAT RAPEDSTSTA VLSGTSSPAT TAPVDSTSSP VAHDDTSSPA TSLSEDSASS PVAHGGTSSP ATSPLRDSTS SPVHSSASIQ NIKTTSDLAS TPDHNGTSVT TTSSALGSAT SPDHSGTSTT TNSSESVLAT TPVYSSMPFS TTKVTSGSAI IPDHNGSSVL PTSSVLGSAT SLVYNTSAIA TTPVSNGTQP SVPSQYPVSP TMATTSSHST IASSSYYSTV PFSTFSSNSS PQLSVGVSFF FLSFYIQNHP FNSSLEDPSS NYYQELKRNI SGLFLQIFNG DFLGISSIKF RSGSVVVEST VVFREGTFSA SDVKSQLIQH KKEADDYNLT ISEVKVNEMQ FPPSAQSRPG VPGWG . It is sometimes possible for the material contained within the vial of "Mucin-1 (Muc1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
