Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Angiotensin-converting enzyme (Ace) Recombinant Protein | Ace recombinant protein

Recombinant Rat Angiotensin-converting enzyme (Ace) , partial

Gene Names
Ace; Dcp1; CD143; StsRR92
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Angiotensin-converting enzyme (Ace); Recombinant Rat Angiotensin-converting enzyme (Ace); partial; Ace recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
36-500. partial
Sequence
LDPGLQPGNFSADEAGAQLFADSYNSSAEVVMFQSTAASWAHDTNITEENARLQEEAALINQEFAEVWGKKAKELYESIWQNFTDQKLRRIIGSVQTLGPANLPLTQRLQYNSLLSNMSRIYSTGKVCFPNKTATCWSLDPELTNILASSRNYAKVLFAWEGWHDAVGIPLRPLYQDFTALSNEAYRQDGFSDTGAYWRSWYESPSFEESLEHLYHQVEPLYLNLHAFVRRALHRRYGDKYINLRGPIPAHLLGDMWAQSWENIYDMVVPFPDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLSPMPPEFWAESMLEKPADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDLHVSLRRGANPGFHEAIGDVLALSVSTPAHLHKIGLLDRVANDIESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNYDWWY
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ace recombinant protein
This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Two most abundant alternatively spliced variants of this gene encode two isozymes - the somatic form and the testicular form that are equally active. Multiple additional alternatively spliced variants have been identified but their full length nature has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88,170 Da
NCBI Official Full Name
angiotensin-converting enzyme
NCBI Official Synonym Full Names
angiotensin I converting enzyme
NCBI Official Symbol
Ace
NCBI Official Synonym Symbols
Dcp1; CD143; StsRR92
NCBI Protein Information
angiotensin-converting enzyme
UniProt Protein Name
Angiotensin-converting enzyme
Protein Family
UniProt Gene Name
Ace
UniProt Synonym Gene Names
Dcp1; ACE

NCBI Description

catalyzes the conversion of angiotensin I to angiotensin II; plays a role in regulation of blood pressure [RGD, Feb 2006]

Uniprot Description

Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. This GPIase activity seems to be crucial for the egg-binding ability of the sperm ().

Research Articles on Ace

Similar Products

Product Notes

The Ace ace (Catalog #AAA1156914) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-500. partial. The amino acid sequence is listed below: LDPGLQPGNF SADEAGAQLF ADSYNSSAEV VMFQSTAASW AHDTNITEEN ARLQEEAALI NQEFAEVWGK KAKELYESIW QNFTDQKLRR IIGSVQTLGP ANLPLTQRLQ YNSLLSNMSR IYSTGKVCFP NKTATCWSLD PELTNILASS RNYAKVLFAW EGWHDAVGIP LRPLYQDFTA LSNEAYRQDG FSDTGAYWRS WYESPSFEES LEHLYHQVEP LYLNLHAFVR RALHRRYGDK YINLRGPIPA HLLGDMWAQS WENIYDMVVP FPDKPNLDVT STMVQKGWNA THMFRVAEEF FTSLGLSPMP PEFWAESMLE KPADGREVVC HASAWDFYNR KDFRIKQCTR VTMDQLSTVH HEMGHVQYYL QYKDLHVSLR RGANPGFHEA IGDVLALSVS TPAHLHKIGL LDRVANDIES DINYLLKMAL EKIAFLPFGY LVDQWRWGVF SGRTPPSRYN YDWWY . It is sometimes possible for the material contained within the vial of "Angiotensin-converting enzyme (Ace), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.