Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Major DNA-binding protein (DBP), partial Recombinant Protein | DBP recombinant protein

Recombinant Suid herpesvirus 1 Major DNA-binding protein (DBP), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Major DNA-binding protein (DBP); partial; Recombinant Suid herpesvirus 1 Major DNA-binding protein (DBP); Major DNA-binding protein; Infected cell protein 8; ICP-8 protein; DBP recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
976-1175; Fragment at the C-terminal
Sequence
GNNRVFQAGNWSGLNGGKHVCPLMVFDRTRHFVLACPRVGFTCSQTGGGAGLHDHSLGEHVKTILADGGPLVQTAVYAAVLHALGARTQHLEPDDWRAIVDDEFLAAALAEINGRVADRDGRWSVEAAAELVRDLEGQTGADGGEETAFDFGACGAGGDVAGLAPASLVPAELGGKRPPPEDDLFDMGAPPEKRLTFDML
Sequence Length
1175
Species
Suid herpesvirus 1 (strain Indiana-Funkhauser / Becker) (SuHV-1) (Pseudorabies virus (strain Indiana-Funkhauser / Becker))
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125,351 Da
NCBI Official Full Name
single-stranded DNA-binding protein
NCBI Official Symbol
UL29
NCBI Protein Information
contains a zinc-finger; single-stranded DNA-binding protein
UniProt Protein Name
Major DNA-binding protein
Protein Family
UniProt Gene Name
DBP
UniProt Synonym Gene Names
ICP8; ICP-8 protein
UniProt Entry Name
DNBI_SUHVF

Uniprot Description

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Research Articles on DBP

Similar Products

Product Notes

The DBP dbp (Catalog #AAA1155478) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 976-1175; Fragment at the C-terminal. The amino acid sequence is listed below: GNNRVFQAGN WSGLNGGKHV CPLMVFDRTR HFVLACPRVG FTCSQTGGGA GLHDHSLGEH VKTILADGGP LVQTAVYAAV LHALGARTQH LEPDDWRAIV DDEFLAAALA EINGRVADRD GRWSVEAAAE LVRDLEGQTG ADGGEETAFD FGACGAGGDV AGLAPASLVP AELGGKRPPP EDDLFDMGAP PEKRLTFDML . It is sometimes possible for the material contained within the vial of "Major DNA-binding protein (DBP), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.