RING finger protein 165 (Rnf165) Recombinant Protein | Rnf165 recombinant protein
Recombinant Mouse RING finger protein 165 (Rnf165)
Gene Names
Rnf165; Akd2; Gm96; Ark2c; AI427432; 2900024M11Rik; G630064H08Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RING finger protein 165 (Rnf165); Recombinant Mouse RING finger protein 165 (Rnf165); Rnf165 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-347, full length protein
Sequence
MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAPDFPLAHPVQSQPGLSAHMAPAHQHSGTLHQSLTPLPTLQFQDVTGPSFLPQALHQQYLLQQQLLEAQHRRLVSHPRRNQDRVSVHPHRLHPSFDFGHQLQTPQPRYLAEGTDWDLSVDAGLSPAQFQVRPIPQHYQHYLATPRMHHFPRNSSSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDSKGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIETQLGADS
Sequence Length
347
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,736 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF165
NCBI Official Synonym Full Names
ring finger protein 165
NCBI Official Symbol
Rnf165
NCBI Official Synonym Symbols
Akd2; Gm96; Ark2c; AI427432; 2900024M11Rik; G630064H08Rik
NCBI Protein Information
E3 ubiquitin-protein ligase RNF165
UniProt Protein Name
E3 ubiquitin-protein ligase RNF165
Protein Family
UniProt Gene Name
Rnf165
UniProt Synonym Gene Names
Ark2C
Uniprot Description
E3 ubiquitin-protein ligase that acts as a regulator of motor axon elongation (PubMed:23610558). Required for efficient motor axon extension in the dorsal forelimb by enhancing the transcriptional responses of the SMAD1/SMAD5/SMAD8 effectors, which are activated downstream of BMP (PubMed:23610558). Acts by mediating ubiquitination and degradation of SMAD inhibitors such as SMAD6, SMAD7, SKI and SNON isoform of SKIL (PubMed:23610558).
Research Articles on Rnf165
Similar Products
Product Notes
The Rnf165 rnf165 (Catalog #AAA1153014) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-347, full length protein. The amino acid sequence is listed below: MVLVHVGYLV LPVFGSVRNR GAPFQRSQHP HATSCRHFHL GPPQPQQLAP DFPLAHPVQS QPGLSAHMAP AHQHSGTLHQ SLTPLPTLQF QDVTGPSFLP QALHQQYLLQ QQLLEAQHRR LVSHPRRNQD RVSVHPHRLH PSFDFGHQLQ TPQPRYLAEG TDWDLSVDAG LSPAQFQVRP IPQHYQHYLA TPRMHHFPRN SSSTQMVVHE IRNYPYPQLH FLALQGLNPS RHTSAVRESY EELLQLEDRL GNVTRGAVQN TIERFTFPHK YKKRRPQDSK GKKDEGEESD TDEKCTICLS MLEDGEDVRR LPCMHLFHQL CVDQWLAMSK KCPICRVDIE TQLGADS. It is sometimes possible for the material contained within the vial of "RING finger protein 165 (Rnf165), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
