Protein cornichon homolog (Cnih) Recombinant Protein | Cnih recombinant protein
Recombinant Mouse Protein cornichon homolog (Cnih)
Gene Names
Cnih; 0610007J15
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein cornichon homolog (Cnih); Recombinant Mouse Protein cornichon homolog (Cnih); Recombinant Protein cornichon homolog (Cnih); Protein cornichon homolog; Cnih recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-144
Sequence
MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSAPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYVLVSS
Sequence Length
144
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,699 Da
NCBI Official Full Name
protein cornichon homolog
NCBI Official Synonym Full Names
cornichon homolog (Drosophila)
NCBI Official Symbol
Cnih
NCBI Official Synonym Symbols
0610007J15
NCBI Protein Information
protein cornichon homolog
UniProt Protein Name
Protein cornichon homolog
UniProt Gene Name
Cnih
UniProt Entry Name
CNIH_MOUSE
Uniprot Description
CNIH: Involved in the selective transport and maturation of TGF-alpha family proteins. Belongs to the cornichon family.
Protein type: Endoplasmic reticulum; Membrane protein, multi-pass; Membrane protein, integral
Cellular Component: Golgi apparatus; membrane; endoplasmic reticulum; integral to membrane
Biological Process: vesicle-mediated transport; transport
Similar Products
Product Notes
The Cnih cnih (Catalog #AAA1151573) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-144. The amino acid sequence is listed below: MAFTFAAFCY MLALLLTAAL IFFAIWHIIA FDELKTDYKN PIDQCNTLNP LVLPEYLIHA FFCVMFLCAA EWLTLGLNMP LLAYHIWRYM SRPVMSAPGL YDPTTIMNAD ILAYCQKEGW CKLAFYLLAF FYYLYGMIYV LVSS. It is sometimes possible for the material contained within the vial of "Protein cornichon homolog (Cnih), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
