Cation efflux system protein CusF (cusF) Recombinant Protein | cusF recombinant protein
Recombinant Escherichia coli Cation efflux system protein CusF (cusF)
Gene Names
cusF; cusX; ECK0565; JW0562; silF; ylcC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cation efflux system protein CusF (cusF); Recombinant Escherichia coli Cation efflux system protein CusF (cusF); cusF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-110, full length protein
Sequence
ANEHHHETMSEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
Sequence Length
89
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,251 Da
NCBI Official Full Name
periplasmic copper- and silver-binding protein
NCBI Official Symbol
cusF
NCBI Official Synonym Symbols
cusX; ECK0565; JW0562; silF; ylcC
NCBI Protein Information
periplasmic copper- and silver-binding protein
UniProt Protein Name
Cation efflux system protein CusF
Protein Family
UniProt Gene Name
cusF
UniProt Synonym Gene Names
cusX; ylcC
NCBI Description
cusF is in the cusCFBA Cu/Ag efflux operon regulated by Cu and Ag. [More information is available at EcoGene: EG14234]. CusF is a periplasmic binding protein involved in the detoxification of copper and silver ions in Escherichia coli as part of the CusCFBA copper/silver efflux system. [More information is available at EcoCyc: G6321].
Uniprot Description
Part of a cation efflux system that mediates resistance to copper and silver. Binds one copper per polypeptide (PubMed:11399769, PubMed:24917681).
Research Articles on cusF
Similar Products
Product Notes
The cusF cusf (Catalog #AAA1151523) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-110, full length protein. The amino acid sequence is listed below: ANEHHHETMS EAQPQVISAT GVVKGIDLES KKITIHHDPI AAVNWPEMTM RFTITPQTKM SEIKTGDKVA FNFVQQGNLS LLQDIKVSQ. It is sometimes possible for the material contained within the vial of "Cation efflux system protein CusF (cusF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
